Transforming Growth Factor-Beta 1 Human Recombinant, GST Tag ( TGF b 1 Human, GST )

Price range: $192.50 through $1,078.00

Novatein Biosciences provides Transforming Growth Factor-Beta 1 Human Recombinant, GST Tag ( TGF b 1 Human, GST ) also known as CED, DPD1, TGFB, TGF-beta-1, Transforming growth factor beta-1 for your R&D

SKU: PT_72110 Category:

Description

Data Sheet

Amino acid sequence KWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS.
Description The Recombinant Human TGF-b1 (aa 309-390) is purified by standard chromatographic techniques and shows a 35kDa band on SDS-PAGE (including GST tag).
Expression host Escherichia Coli.
Formulation The protein solution (500ug/ml) contains 50mM Tris-HCl, pH-7.5 and 10mM L-glutathione (reduced).
Protein Background Transforming growth factor betas (TGF Betas) mediate many cell-cell interactions that occur during embryonic development. Three TGF Betas have been identified in mammals. TGF Beta 1, TGF Beta 2 and TGF Beta 3 are each synthesized as precursor proteins that are very similar in that each is cleaved to yield a 112 amino acid polypeptide that remains associated with the latent portion of the molecule.
Purity Greater than 80.0% as determined by SDS-PAGE.
Reagent Appearance Sterile Filtered solution.
Stability Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Synonyms Transforming growth factor beta-1, TGF-beta-1, CED, DPD1, TGFB.

Additional information

Size

2ug, 100ug, 10ug