Pramlintide ( Pramlintide )

Price range: $192.50 through $539.00

Novatein Biosciences provides Pramlintide ( Pramlintide ) also known as for your R&D

SKU: PT_41826 Category:

Description

Data Sheet

Amino Acid Composition KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY-NH2.
Description Pramlintide Synthetic is a single, non-glycosylated polypeptide chain containing 37 amino acids, having a molecular mass of 3949.4 Dalton and a Molecular formula of C171H267N51O53S2.
Formulation The protein was lyophilized with no additives.
Protein Background Pramlintide acetate is a hormone that is released into the bloodstream, in a similar pattern as insulin. Pramlintide aids in the absorption of glucose by slowing gastric emptying, promoting satiety, and inhibiting inappropriate secretion of glucagon, a catabolic hormone that opposes the effects of insulin.
Purity Greater than 98.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Reagent Appearance Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility It is recommended to reconstitute the lyophilized Pramlintide in sterile 18M-cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions. The Pramlintide is also soluble in 1% Acetic Acid.
Stability Lyophilized Pramlintide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Pramlintide should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Additional information

Size

25mg, 1mg, 5mg