Description
Data Sheet
| Amino acid sequence | AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFKWGESPNRSRRHSPHQALRKGVRR. |
| Biological Activity | The ED50 as determined by the dose-dependant stimulation of Human TF-1 cells is |
| Description | Oncostatin-M (209 a.a.) Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 209 amino acids and having a molecular mass of 23.9kDa. The Oncostatin-M (209 a.a.) is purified by proprietary chromatographic techniques. |
| Expression host | Escherichia Coli. |
| Formulation | Oncostatin-M (209 a.a.) was lyophilized from a concentrated (1mg/ml) solution containing 1x PBS pH-7.4. |
| Inactivation | UV spectroscopy at 280 nm using the absorbency value of 0.85 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics). |
| Protein Background | Oncostatin M is a member of a cytokine family that includes leukemia-inhibitory factor, granulocyte colony-stimulating factor, and interleukin 6. This gene encodes a growth regulator which inhibits the proliferation of a number of tumor cell lines. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. |
| Purity | Greater than 97.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Reagent Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Solubility | It is recommended to reconstitute the lyophilized Oncostatin-M (209 a.a.) in sterile 18M-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions. |
| Stability | Lyophilized Oncostatin-M (209 a.a.) although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Oncostatin-M (209 a.a.) should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
| Synonyms | OSM, MGC20461, Oncostatin M. |
