Description
Data Sheet
| AA Sequence | 10mM HEPES (pH7.4), 0.01% CHAPS and 5mM DTT.*for further dilution you may use either the Storage Buffer or Dilution Buffer. |
| Amino acid sequence | MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALLHFEEHGEVCPAGWRKGDKGMKATHQGVAEYLKENSIKL. |
| Description | Omp Pylori recombinant antigen is produced in E. coli expressing the H. pylori outer membrane protein having the Mw of 23 kDa. Omp Pylori recombinant antigen is well recognized by specific IgG and IgM from H. pylori infected patients. |
| Expression host | E.Coli |
| Formulation | The Omp Pylori recombinant protein is formulated in 1xPBS pH 7.4. |
| Protein Background | Helicobacter pylori, a Gram-negative, microaerophilic bacterium that populates in the stomach, predominantly at the antrum. Helicobacter pylori causes a chronic inflammation of the mucoid lining of stomach and is highly related to the growth of duodenal and gastric ulcers and stomach cancer. Over 50% of the world’s population harbor H. pylori in their upper gastrointestinal tract, infection is more prevalent in developing countries. Thus far, no ideal target H. pylori antigen has been developed for the diagnostic purpose. 23 kDa H. pylori outer membrane protein was identified with a good sensitivity and coverage in the diagnosis of H. pylori infection. |
| Purification Method | Purified by proprietary chromatographic technique. |
| Purity | Greater than 95% pure as determined by 12% PAGE (Coomassie staining). |
| Reagent Appearance | Sterile filtered liquid formulation. |
| Recommendations on use | PKC-a is supplied in 20mM HEPES pH 7.5, 250mM NaCl, 50% glycerol, 2mM EDTA, 2mM EGTA, 0.05%Triton X-100 and 5mM DTT. |
| Stability | Omp Pylori although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles. |
