Description
Data Sheet
| Amino acid sequence | SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ. |
| Biological Activity | The ED50 as determined by a cell proliferation assay using serum free human MCF-7 cells is less than 50ng/ml, corresponding to a specific activity of > 2.0 104 IU/mg. |
| Description | Recombinant Human Neuregulin-1 beta 2 produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 61 amino acids and having a total molecular mass of 7055 Dalton. NRG-1 is purified by proprietary chromatographic techniques. |
| Expression host | Escherichia Coli. |
| Formulation | Lyophilized from a 0.2um filtered solution in PBS, pH 7.4. |
| Protein Background | Neuregulin is a signaling protein for ErbB2/ErbB4 receptor heterodimers on the cardiac muscle cells, playing an important role in heart structure and function through inducing ErbB2/ErbB4 receptor phosphorylation and cardiomyocyte differentiation. Research on molecular level discovered that neuregulin recombinant could make disturbed myocardial cell structure into order and strengthen the connection between myocardial cells by intercalated discs re-organization. Pharmacodynamic experiments in animals showed that neuregulin (NRG1) recombinant can reduce the degree of damage on myocardial cells caused by ischemia, hypoxia and viral infection. |
| Purity | Greater than 96.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Reagent Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| References | Title:Serine Protease Inhibitor Kazal Type 1 Promotes Proliferation of Pancreatic Cancer Cells through the Epidermal Growth Factor Receptor.Publication:Published OnlineFirst September 8, 2009; doi: 10.1158/1541-7786.MCR-08-0567 Mol Cancer Res September 2009 7; 1572.Link: http://mcr.aacrjournals.org/content/7/9/1572.full |
| Solubility | It is recommended to reconstitute the lyophilized NRG1 in sterile 18M-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions. |
| Stability | Lyophilized NRG1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Heregulin should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles. |
| Synonyms | Neuregulin-1, NRG1, GGF, HGL, HRGA, NDF, SMDF, HRG, ARIA, GGF2, HRG1. |

