Macrophage Migration Inhibitory Factor Human Recombinant ( Active ) ( MIF Human, Active )

Price range: $143.00 through $2,910.60

Novatein Biosciences provides Macrophage Migration Inhibitory Factor Human Recombinant (Active) ( MIF Human, Active ) also known as GIF, Glycosylation-inhibiting factor, MIF, MMIF, Phenylpyruvate tautomerase for your R&D

SKU: PT_73035 Category:

Description

Data Sheet

Amino acid sequence MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA.
Biological Activity Human PBMCs were cultured with 0 to 1000ng/ml Human MIF. Production of IL-8 was measured via ELISA after 24 hours. The ED50 which was found to be 88-132ng/ml.
Description MIF human Recombinant was cloned into an E.coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques.Macrophage Inducing Factor Human Recombinant is a single, non-glycosylated, polypeptide chain containing 115 amino acids and having a molecular mass of 12.5 kDa.
Expression host Escherichia Coli.
Formulation MIF-Protein was lyophilized from 10mM sodium phosphate buffer pH-7.5.
Protein Background The cytokine Macrophage migration inhibitory factor (MIF) has been identified to be secreted by the pituitary gland and the monocyte/macrophage and to play an important role in endotoxic shock. MIF has the unique property of being released from macrophages and T cells in response to physiological concentrations of glucocorticoids. The secretion of MIF is tightly regulated and decreases at high, anti-inflammatory steroid concentration.
Purity Greater than 97.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Reagent Appearance Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility It is recommended to reconstitute the lyophilized MIF-Protein in sterile 18M-cm H2O at a concentration between 0.1mg-1mg per 1ml.
Stability Lyophilized MIF-protein although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MIF-protein should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Synonyms Phenylpyruvate tautomerase, Glycosylation-inhibiting factor, GIF, MMIF, MIF.

Additional information

Size

3x10ug, 1mg