Description
Data Sheet
| Amino acid sequence | MGSSHHHHHHSSGLVPRGSHMMEGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPLGSHHHHHH. |
| Description | GNLY Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 159 amino acids and fused to a double His Tag (N+C terminus) and having a total molecular mass of 18.1 kDa.The GNLY is purified by proprietary chromatographic techniques. |
| Expression host | Escherichia Coli. |
| Formulation | The Granulysin protein was lyophilized from a concentrated (1mg/ml) solution containing no additives. |
| Protein Background | GNLY is part of the SAPLIP family and is located in the cytotoxic granules of T cells, which are discharged upon antigen stimulation. GNLY is localized in cytotoxic granules of cytotoxic T lymphocytes and natural killer cells, and it has antimicrobial activity against M. tuberculosis and other organisms. GNLY is an antimicrobial protein that kills intracellular pathogens. GNLY is active against a wide range of microbes, including Gram-positive and Gram-negative bacteria, fungi, and parasites. Kills Mycobacterium tuberculosis. |
| Purity | Greater than 95.0% as determined by SDS-PAGE. |
| Reagent Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Solubility | It is recommended to reconstitute the lyophilized Granulysin in sterile 18M-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions. |
| Stability | Lyophilized Granulysin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Granulysin should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
| Synonyms | LAG2, Lymphokine LAG-2, TLA519, NKG5, LAG2, D2S69E, Granulysin, T-cell activation protein 519, GNLY, D2S69E. |
