Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| interferon regulatory factor 2 | Polyclonal | IgG | Rabbit | Human, Rat | WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human IRF2 (317-348aa MTPASSSSRPDRETRASVIKKTSDITQARVKS), different from the related mouse sequence by three amino acids. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
IRF2 |
Protein |
Interferon regulatory factor 2 |
Uniprot ID |
P14316 |
Function |
|
Tissue Specificity |
|
Sub-cellular localization |
|
Sequence Similarities |
|
Aliases |
DKFZp686F0244 antibody|Interferon regulatory factor 2 antibody|IRF 2 antibody|IRF-2 antibody|IRF2 antibody|IRF2_HUMAN antibody |
Application Details
Anti- IRF2 antibody, ASA-B1068, Western blotting
All lanes: Anti IRF2 (ASA-B1068) at 0.5ug/ml
Lane 1: Rat Intestine Tissue Lysate at 50ug
Lane 2: SW620 Whole Cell Lysate at 40ug
Lane 3: COLO320 Whole Cell Lysate at 40ug
Lane 4: HELA Whole Cell Lysate at 40ug
Lane 5: A549 Whole Cell Lysate at 40ug
Predicted bind size: 39KD
Observed bind size: 50KD
All lanes: Anti IRF2 (ASA-B1068) at 0.5ug/ml
Lane 1: Rat Intestine Tissue Lysate at 50ug
Lane 2: SW620 Whole Cell Lysate at 40ug
Lane 3: COLO320 Whole Cell Lysate at 40ug
Lane 4: HELA Whole Cell Lysate at 40ug
Lane 5: A549 Whole Cell Lysate at 40ug
Predicted bind size: 39KD
Observed bind size: 50KD
