Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| keratin 1, type II | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the N-terminus of mouse Cytokeratin 1 (223-257aa LQQVDTTTRTQNLDPFFENYISILRRKVDSLKSD Q), different from the related human sequence by ten amino acids, and from the related rat sequence by five amino acids. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
KRT1 |
Protein |
Keratin, type II cytoskeletal 1 |
Uniprot ID |
P04104 |
Function |
|
Tissue Specificity |
|
Sub-cellular localization |
|
Sequence Similarities |
|
Aliases |
67 kDa cytokeratin antibody|CK-1 antibody|CK1 antibody|Cytokeratin-1 antibody|Cytokeratin1 antibody|EHK antibody|EHK1 antibody| Epidermolytic hyperkeratosis 1 antibody|EPPK antibody|Hair alpha protein antibody|K1 antibody|K2C1_HUMAN antibody|Keratin antibody| Keratin type II cytoskeletal 1 antibody|Keratin-1 antibody|Keratin1 antibody|KRT 1 antibody|Krt1 antibody|KRT1A antibody|NEPPK antibody|type II cytoskeletal 1 antibody|Type II keratin Kb1 antibody|Type-II keratin Kb1 antibody |
Application Details
Anti- Cytokeratin 1 antibody, ASA-B0567, Western blotting
All lanes: Anti Cytokeratin 1 (ASA-B0567) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: Rat Skeletal Muscle Tissue Lysate at 50ug
Lane 3: Rat Spleen Tissue Lysate at 50ug
Lane 4: SKOV Whole Cell Lysate at 40ug
Lane 5: A431 Whole Cell Lysate at 40ug
Predicted bind size: 67KD
Observed bind size: 67KD
All lanes: Anti Cytokeratin 1 (ASA-B0567) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: Rat Skeletal Muscle Tissue Lysate at 50ug
Lane 3: Rat Spleen Tissue Lysate at 50ug
Lane 4: SKOV Whole Cell Lysate at 40ug
Lane 5: A431 Whole Cell Lysate at 40ug
Predicted bind size: 67KD
Observed bind size: 67KD
Anti- Cytokeratin 1 antibody, ASA-B0567, IHC(P)
IHC(P): Rat Lung Tissue
IHC(P): Rat Lung Tissue
Anti- Cytokeratin 1 antibody, ASA-B0567, IHC(P)
IHC(P): Human Oesophagus Squama Cancer Tissue
IHC(P): Human Oesophagus Squama Cancer Tissue
