Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| heat shock 70kDa protein 9 (mortalin) | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human Grp75 (646-679aa KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ), identical to the related mouse and rat sequences. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
HSPA9 |
Protein |
Stress-70 protein, mitochondrial |
Uniprot ID |
P38646 |
Function |
|
Tissue Specificity |
|
Sub-cellular localization |
|
Sequence Similarities |
|
Aliases |
75 kDa glucose regulated protein antibody|75 kDa glucose-regulated protein antibody|CSA antibody|Glucose Regulated Protein antibody|Grp 75 antibody|GRP-75 antibody|GRP75 antibody|GRP75_HUMAN antibody|Heat shock 70 kDa protein 9 antibody|Heat shock 70kD protein 9 antibody|heat shock 70kDa protein 9 antibody|Heat shock 70kDa protein 9B antibody|Heat shock protein 74 kDa A antibody|Heat shock protein A antibody|Heat shock protein cognate 74 antibody|Hsc74 antibody|Hsp74 antibody|Hsp74a antibody|HSPA9 antibody|Hspa9a antibody| HSPA9B antibody|MGC4500 antibody|mitochondrial antibody|Mortalin 2 antibody|Mortalin antibody|Mortalin perinuclear antibody| Mortalin2 antibody|MOT 2 antibody|MOT antibody|MOT2 antibody|Mthsp70 antibody|p66 mortalin antibody|P66 MOT antibody|PBP74 antibody| Peptide binding protein 74 antibody|Peptide-binding protein 74 antibody|Stress 70 protein mitochondrial antibody|Stress 70 protein mitochondrial precursor antibody|Stress-70 protein antibody |
Application Details
Anti- Grp75 antibody, ASA-B0824, Western blotting
All lanes: Anti Grp75 (ASA-B0824) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: Rat Thymus Tissue Lysate at 50ug
Lane 3: Rat Testis Tissue Lysate at 50ug
Lane 4: Mouse Liver Tissue Lysate at 50ug
Lane 5: Mouse Thymus Tissue Lysate at 50ug
Lane 6: Mouse Testis Tissue Lysate at 50ug
Lane 7: HELA Whole Cell Lysate at 40ug
Lane 8: MCF-7 Whole Cell Lysate at 40ug
Lane 9: SW620 Whole Cell L
All lanes: Anti Grp75 (ASA-B0824) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: Rat Thymus Tissue Lysate at 50ug
Lane 3: Rat Testis Tissue Lysate at 50ug
Lane 4: Mouse Liver Tissue Lysate at 50ug
Lane 5: Mouse Thymus Tissue Lysate at 50ug
Lane 6: Mouse Testis Tissue Lysate at 50ug
Lane 7: HELA Whole Cell Lysate at 40ug
Lane 8: MCF-7 Whole Cell Lysate at 40ug
Lane 9: SW620 Whole Cell L
Anti- Grp75 antibody, ASA-B0824,IHC(P)
IHC(P): Mouse Kidney Tissue
IHC(P): Mouse Kidney Tissue
Anti- Grp75 antibody, ASA-B0824,IHC(P)
IHC(P): Rat Kidney Tissue
IHC(P): Rat Kidney Tissue
