Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| IKAROS family zinc finger 1 (Ikaros) | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human Ikaros (428-459aa LKEEHRAYDLLRAASENSQDALRVVSTSGEQM), different from the related mouse sequence by five amino acids. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
IKZF1 |
Protein |
DNA-binding protein Ikaros |
Uniprot ID |
Q13422 |
Function |
|
Tissue Specificity |
|
Sub-cellular localization |
|
Sequence Similarities |
|
Aliases |
CLL associated antigen KW 6 antibody|DNA-binding protein Ikaros antibody|hIk 1 antibody|Hs.54452 antibody|IK1 antibody|Ikaros (zinc finger protein) antibody|IKAROS antibody|IKAROS family zinc finger 1 (Ikaros) antibody|Ikaros family zinc finger protein 1 antibody|Ikzf1 antibody| IKZF1_HUMAN antibody|LYF1 antibody|Lymphoid transcription factor LyF-1 antibody|PRO0758 antibody|Zinc finger protein subfamily 1A 1 (Ikaros) antibody|Zinc finger protein subfamily 1A 1 antibody|Zinc finger protein, subfamily 1A, member 1 antibody|ZNFN1A1 antibody |
Application Details
Anti- Ikaros antibody, ASA-B0979, Western blotting
All lanes: Anti Ikaros (ASA-B0979) at 0.5ug/ml
WB: HELA Whole Cell Lysate at 40ug
Predicted bind size: 58KD
Observed bind size: 58KD
All lanes: Anti Ikaros (ASA-B0979) at 0.5ug/ml
WB: HELA Whole Cell Lysate at 40ug
Predicted bind size: 58KD
Observed bind size: 58KD
Anti- Ikaros antibody, ASA-B0979, IHC(P)
IHC(P): Mouse Spleen Tissue
IHC(P): Mouse Spleen Tissue
Anti- Ikaros antibody, ASA-B0979, IHC(P)
IHC(P): Rat Spleen Tissue
IHC(P): Rat Spleen Tissue
