Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| kininogen 1 | Polyclonal | IgG | Rabbit | Mouse | IHC-P, WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence in the middle region of mouse Kininogen 1 (227-259aa ECRGNLFMDINNKIANFSQSCTLYSGDDLVEA L), different from the related rat sequence by thirteen amino acids. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
KNG1 |
Protein |
Kininogen-1 |
Uniprot ID |
O08677 |
Function |
|
Tissue Specificity |
|
Sub-cellular localization |
|
Sequence Similarities |
|
Aliases |
Alpha-2-thiol proteinase inhibitor antibody|BDK antibody|BK antibody|Bradykinin antibody|Fitzgerald factor antibody|High molecular weight kininogen antibody|HMWK antibody|Ile-Ser-Bradykinin antibody|Kallidin I antibody|Kallidin II antibody|Kininogen antibody|Kininogen1|KNG antibody|KNG1 antibody|KNG1_HUMAN antibody|Low molecular weight growth-promoting factor antibody|Williams-Fitzgerald-Flaujeac factor antibody |
Application Details
Anti- Kininogen 1 antibody, ASA-B1125, Western blotting
All lanes: Anti Kininogen 1 (ASA-B1125) at 0.5ug/ml
Lane 1: Mouse Lung Tissue Lysate at 50ug
Lane 2: Mouse Testis Tissue Lysate at 50ug
Lane 3: Mouse Liver Tissue Lysate at 50ug
Lane 4: HEPA Whole Cell Lysate at 40ug
Lane 5: NEURO Whole Cell Lysate at 40ug
Predicted bind size: 73KD
Observed bind size: 73KD
All lanes: Anti Kininogen 1 (ASA-B1125) at 0.5ug/ml
Lane 1: Mouse Lung Tissue Lysate at 50ug
Lane 2: Mouse Testis Tissue Lysate at 50ug
Lane 3: Mouse Liver Tissue Lysate at 50ug
Lane 4: HEPA Whole Cell Lysate at 40ug
Lane 5: NEURO Whole Cell Lysate at 40ug
Predicted bind size: 73KD
Observed bind size: 73KD
Anti- Kininogen 1 antibody, ASA-B1125, IHC(P)
IHC(P): Mouse Kidney Tissue
IHC(P): Mouse Kidney Tissue
