Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| monoamine oxidase A | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human MAOA (457-493aa REVLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWER), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
MAOA |
Protein |
Amine oxidase [flavin-containing] A |
Uniprot ID |
P21397 |
Function |
|
Tissue Specificity |
|
Sub-cellular localization |
|
Sequence Similarities |
|
Aliases |
Amine oxidase [flavin containing] A antibody|Amine oxidase [flavin-containing] A antibody|AOFA antibody|AOFA_HUMAN antibody|EC 1.4.3.4 antibody|MAO A antibody|MAO-A antibody|Maoa antibody|Monoamine oxidase A antibody|Monoamine oxidase type A antibody |
Application Details
Anti- MAOA antibody, ASA-B1213, Western blotting
All lanes: Anti MAOA (ASA-B1213) at 0.5ug/ml
Lane 1: Rat Kidney Tissue Lysate at 50ug
Lane 2: Mouse Kidney Tissue Lysate at 50ug
Lane 3: COLO320 Whole Cell Lysate at 40ug
Lane 4: HEPG2 Whole Cell Lysate at 40ug
Lane 5: HEPA Whole Cell Lysate at 40ug
Predicted bind size: 60KD
Observed bind size: 60KD
All lanes: Anti MAOA (ASA-B1213) at 0.5ug/ml
Lane 1: Rat Kidney Tissue Lysate at 50ug
Lane 2: Mouse Kidney Tissue Lysate at 50ug
Lane 3: COLO320 Whole Cell Lysate at 40ug
Lane 4: HEPG2 Whole Cell Lysate at 40ug
Lane 5: HEPA Whole Cell Lysate at 40ug
Predicted bind size: 60KD
Observed bind size: 60KD
Anti- MAOA antibody, ASA-B1213,IHC(P)
IHC(P): Mouse Cardiac Muscle Tissue
IHC(P): Mouse Cardiac Muscle Tissue
Anti- MAOA antibody, ASA-B1213,IHC(P)
IHC(P): Rat Cardiac Muscle Tissue
IHC(P): Rat Cardiac Muscle Tissue
