Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| peroxiredoxin 4 | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, ICC, WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human Peroxiredoxin 4 (178-2081aa SDLTHQISKDYGVYLEDSGHTLRGLFIIDDK), different from the related mouse and rat sequences by one amino acid. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
PRDX4 |
Protein |
Peroxiredoxin-4 |
Uniprot ID |
Q13162 |
Function |
Probably involved in redox regulation of the cell. Regulates the activation of NF-kappa-B in the cytosol by a modulation of I-kappa-B-alpha phosphorylation. |
Tissue Specificity |
|
Sub-cellular localization |
Cytoplasm. |
Sequence Similarities |
Belongs to the AhpC/TSA family. |
Aliases |
Antioxidant enzyme 372 antibody|Antioxidant enzyme AOE372 antibody|AOE37 2 antibody|AOE37-2 antibody|AOE372 antibody|EC 1.11.1.15 antibody|Peroxiredoxin IV antibody|Peroxiredoxin-4 antibody|Peroxiredoxin4 antibody|PRDX 4 antibody| PRDX4 antibody|PRDX4_HUMAN antibody|PRX 4 antibody|Prx IV antibody|Prx-IV antibody|PRX4 antibody|PrxIV antibody|Thioredoxin dependent peroxide reductase A0372 antibody|Thioredoxin Peroxidase (Antioxidant Enzyme) antibody| Thioredoxin peroxidase antibody|Thioredoxin peroxidase AO372 antibody| Thioredoxin-dependent peroxide reductase A0372 antibody|TRANK antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human, Mouse, Rat | AssaySolutio’s ECL kit |
| Immunohistochemistry(Paraffin-embedded Section) | 0.5-1μg/ml | Human, Mouse, Rat | AssaySolutio’s IHC/ICC Detection kit |
| Immunocytochemistry | 0.5-1μg/ml | Human | AssaySolutio’s IHC/ICC Detection kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P) and ICC. *Blocking peptide can be purchased at $65. Contact us for more information

Anti- Peroxiredoxin 4 antibody, ASA-B1510, Western blotting
All lanes: Anti Peroxiredoxin 4 (ASA-B1510) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Mouse Brain Tissue Lysate at 50ug
Lane 3: HELA Whole Cell Lysate at 40ug
Predicted bind size: 31KD
Observed bind size: 31KD
All lanes: Anti Peroxiredoxin 4 (ASA-B1510) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Mouse Brain Tissue Lysate at 50ug
Lane 3: HELA Whole Cell Lysate at 40ug
Predicted bind size: 31KD
Observed bind size: 31KD

Anti- Peroxiredoxin 4 antibody, ASA-B1510, IHC(P)
IHC(P): Mouse Brain Tissue
IHC(P): Mouse Brain Tissue

Anti- Peroxiredoxin 4 antibody, ASA-B1510, IHC(P)
IHC(P): Rat Brain Tissue
IHC(P): Rat Brain Tissue




