Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| runt-related transcription factor 1 | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence in the middle region of human RUNX1(200-233aa ELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFN), identical to the related mouse and rat sequences. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
RUNX1 |
Protein |
Runt-related transcription factor 1 |
Uniprot ID |
Q01196 |
Function |
CBF binds to the core site, 5′-PYGPYGGT-3′, of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL-3 and GM-CSF promoters. The alpha subunit binds DNA and appears to have a role in the development of normal hematopoiesis. Isoform AML-1L interferes with the transactivation activity of RUNX1. Acts synergistically with ELF4 to transactivate the IL-3 promoter and with ELF2 to transactivate the mouse BLK promoter. Inhibits KAT6B- dependent transcriptional activation. Controls the anergy and suppressive function of regulatory T-cells (Treg) by associating with FOXP3. Activates the expression of IL2 and IFNG and down- regulates the expression of TNFRSF18, IL2RA and CTLA4, in conventional T-cells (PubMed:17377532). |
Tissue Specificity |
Expressed in all tissues examined except brain and heart. Highest levels in thymus, bone marrow and peripheral blood. |
Sub-cellular localization |
Nucleus. |
Sequence Similarities |
Contains 1 Runt domain. |
Aliases |
Acute myeloid leukemia 1 antibody|Acute myeloid leukemia 1 protein antibody|alpha subunit antibody|alpha subunit core binding factor antibody|AML 1 antibody|AML1 antibody|AML1 EVI 1 antibody|AML1 EVI 1 fusion protein antibody|Aml1 oncogene antibody|AMLCR 1 antibody|AMLCR1 antibody|CBF alpha 2 antibody|CBF-alpha-2 antibody|CBFA 2 antibody|CBFA2 antibody|Core binding factor alpha 2 subunit antibody|Core binding factor runt domain alpha subunit 2 antibody|Core-binding factor subunit alpha-2 antibody|EVI 1 antibody|EVI1 antibody|Oncogene AML 1 antibody|Oncogene AML-1 antibody|OTTHUMP00000108696 antibody|OTTHUMP00000108697 antibody|OTTHUMP00000108699 antibodyOTTHUMP00000108700 antibody|OTTHUMP00000108702 antibody|PEA2 alpha B antibody|PEA2-alpha B antibody|PEBP2 alpha B antibody|PEBP2-alpha B antibody|PEBP2A2 antibody|PEBP2aB antibody|Polyomavirus enhancer binding protein 2 alpha B subunit antibody|Polyomavirus enhancer-binding protein 2 alpha B subunit antibody|Run1 antibody|Runt related transcription factor 1 antibody|Runt-related transcription factor 1 antibody|RUNX 1 antibody|Runx1 antibody|RUNX1_HUMAN antibody|SL3 3 enhancer factor 1 alpha B subunit antibody|SL3-3 enhancer factor 1 alpha B subunit antibody|SL3/AKV core binding factor alpha B subunit antibody|SL3/AKV core-binding factor alpha B subunit antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human | AssaySolutio’s ECL kit |
| Immunohistochemistry(Paraffin-embedded Section) | 0.5-1μg/ml | Human, Mouse, Rat | AssaySolutio’s IHC/ICC Detection kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information

Anti-RUNX1/AML1 antibody , ASA-B1638–1.jpg
All lanes: Anti RUNX1 (ASA-B1638) at 0.5ug/ml
WB: Recombinant Human RUNX1 Protein 0.5ng
Predicted bind size: 50KD
Observed bind size: 50KD
All lanes: Anti RUNX1 (ASA-B1638) at 0.5ug/ml
WB: Recombinant Human RUNX1 Protein 0.5ng
Predicted bind size: 50KD
Observed bind size: 50KD

Anti-RUNX1/AML1 antibody , ASA-B1638–2.jpg
IHC(P): Rat Thymus Tissue
IHC(P): Rat Thymus Tissue

Anti-RUNX1/AML1 antibody , ASA-B1638–3.jpg
IHC(P): Human Mammary Cancer Tissue
IHC(P): Human Mammary Cancer Tissue




