Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| surfactant protein A1/surfactant protein A2 | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, IHC-F, WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human SFTPA1/2(206-237aa VNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRN), different from the related mouse sequence by four amino acids, and from the related rat sequence by five amino acids. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
SFTPA1/2 |
Protein |
Pulmonary surfactant-associated protein A1/Pulmonary surfactant-associated protein A2 |
Uniprot ID |
Q8IWL1 |
Function |
In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration. |
Tissue Specificity |
|
Sub-cellular localization |
Secreted, extracellular space, extracellular matrix. Secreted, extracellular space, surface film. |
Sequence Similarities |
Belongs to the SFTPA family. |
Aliases |
35 kDa pulmonary surfactant associated protein antibody|35 kDa pulmonary surfactant-associated protein antibody|Alveolar proteinosis protein antibody| COLEC4 antibody|Collectin 4 antibody|Collectin-4 antibody|FLJ50593 antibody|FLJ51913 antibody|FLJ61144 antibody| FLJ77898, antibody| FLJ79095 antibody|FLJ99559 antibody|MGC133365 antibody| MGC198590 antibody|OTTHUMP00000019928 antibody|OTTHUMP00000019929 antibody| OTTHUMP00000019930 antibody|OTTHUMP00000019931 antibody|PSAP antibody|PSP A antibody|PSP-A antibody|PSPA antibody| pulmonary surfactant -associated protein, 35-KD antibody|pulmonary surfactant apoprotein PSP-A antibody|pulmonary surfactant associated protein A1 antibody|Pulmonary surfactant-associated protein A1 antibody| SFTA1 _ HUMAN antibody|SFTP1 antibody|SFTPA1 antibody|SFTPA1B antibody|SP A antibody|SP A1 antibody| SP-A antibody|SP-A1 antibody|SPA antibody|SPA1 antibody|surfactant protein A1 antibody|surfactant protein A1 variant AB’D’ 6A2 antibody|surfactant protein A1 variant AB’D’ 6A3 antibody|surfactant protein A1 variant AB’D’ 6A4 antibody| surfactant protein A1 variant ACD’ 6A2 antibody| surfactant protein A1 variant ACD’ 6A3 antibody|surfactant protein A1 variant ACD’ 6A4 antibody| surfactant protein A1 variant AD’ 6A antibody|surfactant protein A1 variant AD’ 6A2 antibody|surfactant protein A1 variant AD’ 6A3 antibody| surfactant protein A1 variant AD’ 6A4 antibody|surfactant protein A1B antibody| surfactant, pulmonary associated protein A1A antibody|surfactant, pulmonary associated protein A1B antibody|surfactant-associated protein, pulmonary 1 antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human, Mouse, Rat | AssaySolutio’s ECL kit |
| Immunohistochemistry(Paraffin-embedded Section) | 0.5-1μg/ml | Human, Mouse, Rat | AssaySolutio’s IHC/ICC Detection kit |
| Immunohistochemistry(Frozen Section) | 0.5-1μg/ml | Mouse, Rat | AssaySolutio’s IHC/ICC Detection kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P) and ICC. *Blocking peptide can be purchased at $65. Contact us for more information

Anti- SFTP A1/2 antibody, ASA-B1678, Western blotting
All lanes: Anti SFTP (ASA-B1678) at 0.5ug/ml
Lane 1: Rat Lung Tissue Lysate at 50ug
Lane 2: Mouse Lung Tissue Lysate at 50ug
Lane 3: A549 Whole Cell Lysate at 40ug
Predicted bind size: 26KD
Observed bind size: 26KD
All lanes: Anti SFTP (ASA-B1678) at 0.5ug/ml
Lane 1: Rat Lung Tissue Lysate at 50ug
Lane 2: Mouse Lung Tissue Lysate at 50ug
Lane 3: A549 Whole Cell Lysate at 40ug
Predicted bind size: 26KD
Observed bind size: 26KD

Anti- SFTP A1/2 antibody, ASA-B1678, IHC(P)
IHC(P): Mouse Lung Tissue
IHC(P): Mouse Lung Tissue

Anti- SFTP A1/2 antibody, ASA-B1678, IHC(P)
IHC(P): Rat Lung Tissue
IHC(P): Rat Lung Tissue




