Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| protein tyrosine phosphatase, non-receptor type 11 | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the N-terminus of human SHP2 (69-99aa EKFATLAELVQYYMEHHGQLKEKNGDVIELK), identical to the related mouse and rat sequences. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
PTPN11 |
Protein |
Tyrosine-protein phosphatase non-receptor type 11 |
Uniprot ID |
Q06124 |
Function |
|
Tissue Specificity |
|
Sub-cellular localization |
|
Sequence Similarities |
|
Aliases |
phosphatase 2 antibody|Protein tyrosine phosphatase 2C antibody|Protein Tyrosine Phosphatase Non receptor Type 11 antibody|Protein-tyrosine phosphatase 1D antibody|Protein-tyrosine phosphatase 2C antibody|PTN11_HUMAN antibody|PTP 1D antibody|PTP 2C antibody|PTP-1D antibody|PTP-2C antibody|PTP1D antibody|PTP2C antibody|PTPN 11 antibody|PTPN11 antibody|PTPN11 antibody|SAP2 antibody|SH PTP2 antibody|SH PTP3 antibody|SH-PTP2 antibody|SH-PTP3 antibody|SH2 domain containing protein tyrosine phosphatase 2 antibody|SHIP2 antibody|SHP 2 antibody|SHP-2 antibody|Shp2 antibody|SHPTP 2 antibody|SHPTP2 antibody|SHPTP3 antibody|SIT protein precursor antibody| Syp antibody|Tyrosine protein phosphatase non receptor type 11 antibody|Tyrosine-protein phosphatase non-receptor type 11 antibody |
Application Details
Anti- SHP2 antibody, ASA-B1689, Western blotting
All lanes: Anti SHP2 (ASA-B1689) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Mouse Brain Tissue Lysate at 50ug
Lane 3: Rat Cardiac Muscle Tissue Lysate at 50ug
Lane 4: Mouse Kidney Tissue Lysate at 50ug
Lane 5: HELA Whole Cell Lysate at 40ug
Lane 6: SW620 Whole Cell Lysate at 40ug
Lane 7: HEPG2 Whole Cell Lysate at 40ug
Lane 8: JURKAT Whole Cell Lysate at 40ug
Predicted bind size: 68
All lanes: Anti SHP2 (ASA-B1689) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Mouse Brain Tissue Lysate at 50ug
Lane 3: Rat Cardiac Muscle Tissue Lysate at 50ug
Lane 4: Mouse Kidney Tissue Lysate at 50ug
Lane 5: HELA Whole Cell Lysate at 40ug
Lane 6: SW620 Whole Cell Lysate at 40ug
Lane 7: HEPG2 Whole Cell Lysate at 40ug
Lane 8: JURKAT Whole Cell Lysate at 40ug
Predicted bind size: 68
Anti- SHP2 antibody, ASA-B1689,IHC(P)
IHC(P): Mouse Cardiac Muscle Tissue
IHC(P): Mouse Cardiac Muscle Tissue
Anti- SHP2 antibody, ASA-B1689,IHC(P)
IHC(P): Rat Skeletal Muscle Tissue
IHC(P): Rat Skeletal Muscle Tissue
