SLC12A1 Antibody

$365.00

In stock

SKU: ASA-B1702 Category:

Description

Overview

Long Name

Antibody Type

Antibody Isotype

Host

Species Reactivity

Validated Applications

Purification 

solute carrier family 12 (sodium/potassium/chloride transporters), member 1 Polyclonal IgG Rabbit Human, Mouse, Rat IHC-P, WB Immunogen affinity purified.

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human SLC12A1(52-83aa DEAQKRLRISFRPGNQECYDNFLQSGETAKTD), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids.

Properties

Form

Lyophilized

Size

100 µg/vial

Contents

Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request.

Concentration

Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration).

Storage

At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

Additional Information Regarding the Antigen

Gene

SLC12A1

Protein

Solute carrier family 12 member 1

Uniprot ID

Q13621

Function

Electrically silent transporter system. Mediates sodium and chloride reabsorption. Plays a vital role in the regulation of ionic balance and cell volume.

Tissue Specificity

Kidney specific.

Sub-cellular localization

Membrane; Multi-pass membrane protein.

Sequence Similarities

Aliases

BSC1 antibody|Bumetanide sensitive sodium 3 antibody|Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2 antibody|Kidney specific Na K Cl symporter antibody|Kidney-specific Na-K-Cl symporter antibody|MGC48843 antibody|Na K 2Cl cotransporter antibody|NKCC2 antibody|potassiumchloride cotransporter 2 antibody|S12A1_HUMAN antibody|Slc12a1 antibody|sodium potassium chloride cotransporter 2 antibody|solute carrier family 12 (sodium/potassium/chloride transporters) antibody|Solute carrier family 12 member 1 antibody

Application Details

Application Concentration* Species Validated Using**
Western blot 0.1-0.5μg/ml Human, Mouse AssaySolutio’s ECL kit
Immunohistochemistry(Paraffin-embedded Section) 0.5-1μg/ml Human, Mouse, Rat AssaySolutio’s IHC/ICC Detection kit

AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information

Anti- SLC12A1 antibody, ASA-B1702, Western blotting
All lanes: Anti SLC12A1 (ASA-B1702) at 0.5ug/ml
Lane 1: HELA Whole Cell Lysate at 40ug
Lane 2: JURKAT Whole Cell Lysate at 40ug
Lane 3: SKOV Whole Cell Lysate at 40ug
Lane 4: Mouse Kidney Tissue Lysate at 50ug
Predicted bind size: 121KD
Observed bind size: 121KD
Anti- SLC12A1 antibody, ASA-B1702, IHC(P)
IHC(P): Mouse Kidney Tissue
Anti- SLC12A1 antibody, ASA-B1702, IHC(P)
IHC(P): Rat Kidney Tissue