SLC22A2 Antibody

$365.00

In stock

SKU: ASA-B1711 Category:

Description

Overview

Long Name

Antibody Type

Antibody Isotype

Host

Species Reactivity

Validated Applications

Purification 

solute carrier family 22 (organic cation transporter), member 2 Polyclonal IgG Rabbit Human, Mouse, Rat IHC-P, WB Immunogen affinity purified.

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human SLC22A2 (524-555aa ETIEEAENMQRPRKNKEKMIYLQVQKLDIPLN), different from the related mouse sequence by five amino acids, and from the related rat sequence by seven amino acids.

Properties

Form

Lyophilized

Size

100 µg/vial

Contents

Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request.

Concentration

Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration).

Storage

At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

Additional Information Regarding the Antigen

Gene

SLC22A2

Protein

Solute carrier family 22 member 2

Uniprot ID

O15244

Function

Mediates tubular uptake of organic compounds from circulation. Mediates the influx of agmatine, dopamine, noradrenaline (norepinephrine), serotonin, choline, famotidine, ranitidine, histamin, creatinine, amantadine, memantine, acriflavine, 4-[4-(dimethylamino)-styryl]-N-methylpyridinium ASP, amiloride, metformin, N-1-methylnicotinamide (NMN), tetraethylammonium (TEA), 1-methyl-4-phenylpyridinium (MPP), cimetidine, cisplatin and oxaliplatin. Cisplatin may develop a nephrotoxic action. Transport of creatinine is inhibited by fluoroquinolones such as DX-619 and LVFX. This transporter is a major determinant of the anticancer activity of oxaliplatin and may contribute to antitumor specificity.

Tissue Specificity

Mainly expressed in kidney. Localized at the luminal membrane and basolateral membrane of kidney distal tubule and proximal tubules. To a lower extent, expressed in neurons of the cerebral cortex and in various subcortical nuclei (at protein levels). Also detected in secretory phase endometrium; in scattered cells in the stroma.

Sub-cellular localization

Membrane ; Multi-pass membrane protein .

Sequence Similarities

Aliases

MGC32628 antibody|OCT 2 antibody|OCT2 antibody|Organic cation transporter 2 antibody|Organic cation transporter antibody|RP11-317M22.2 antibody|Solute carrier family 22 (organic cation transporter) member 2 antibody|Solute carrier family 22 member 2 antibody

Application Details

Application Concentration* Species Validated Using**
Western blot 0.1-0.5μg/ml Mouse, Rat Human AssaySolutio’s ECL kit

AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information

Anti- SLC22A2 antibody, ASA-B1711, Western blotting
All lanes: Anti SLC22A2 (ASA-B1711) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Mouse Brain Tissue Lysate at 50ug
Predicted bind size: 63KD
Observed bind size: 63KD
Anti- SLC22A2 antibody, ASA-B1711, IHC(P)
IHC(P): Mouse Kidney Tissue
Anti- SLC22A2 antibody, ASA-B1711, IHC(P)
IHC(P): Rat Kidney Tissue