Villin Antibody

$365.00

In stock

SKU: ASA-B1973 Category:

Description

Overview

Long Name

Antibody Type

Antibody Isotype

Host

Species Reactivity

Validated Applications

Purification 

villin 1 Polyclonal IgG Rabbit Human, Mouse, Rat IHC-P, WB Immunogen affinity purified.

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human Villin (770-799 aa EQLVNKPVEELPEGVDPSRKEEHLSIEDFT), different from the related mouse sequence by three amino acids.

Properties

Form

Lyophilized

Size

100 µg/vial

Contents

Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request.

Concentration

Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration).

Storage

At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

Additional Information Regarding the Antigen

Gene

VIL1

Protein

Villin-1

Uniprot ID

P09327

Function

Epithelial cell-specific Ca(2+)-regulated actin- modifying protein that modulates the reorganization of microvillar actin filaments. Plays a role in the actin nucleation, actin filament bundle assembly, actin filament capping and severing. Binds phosphatidylinositol 4,5-bisphosphate (PIP2) and lysophosphatidic acid (LPA); binds LPA with higher affinity than PIP2. Binding to LPA increases its phosphorylation by SRC and inhibits all actin-modifying activities. Binding to PIP2 inhibits actin-capping and -severing activities but enhances actin-bundling activity. Regulates the intestinal epithelial cell morphology, cell invasion, cell migration and apoptosis. Protects against apoptosis induced by dextran sodium sulfate (DSS) in the gastrointestinal epithelium. Appears to regulate cell death by maintaining mitochondrial integrity. Enhances hepatocyte growth factor (HGF)-induced epithelial cell motility, chemotaxis and wound repair. Upon S.flexneri cell infection, its actin-severing activity enhances actin-based motility of the bacteria and plays a role during the dissemination.

Tissue Specificity

Specifically expressed in epithelial cells. Major component of microvilli of intestinal epithelial cells and kidney proximal tubule cells. Expressed in canalicular microvilli of hepatocytes (at protein level).

Sub-cellular localization

Cytoplasm, cytoskeleton. Cell projection, lamellipodium. Cell projection, ruffle. Cell projection, microvillus. Cell projection, filopodium tip . Cell projection, filopodium . Note: Relocalized in the tip of cellular protrusions and filipodial extensions upon infection with S.flexneri in primary intestinal epithelial cells (IEC) and in the tail-like structures forming the actin comets of S.flexneri. Redistributed to the leading edge of hepatocyte growth factor (HGF)-induced lamellipodia (By similarity). Rapidly redistributed to ruffles and lamellipodia structures in response to autotaxin, lysophosphatidic acid (LPA) and epidermal growth factor (EGF) treatment.

Sequence Similarities

Belongs to the villin/gelsolin family.

Aliases

D2S1471 antibody|OTTHUMP00000164145 antibody|VIL antibody|VIL1 antibody| VILI_HUMAN antibody|Villin 1 antibody|Villin-1 antibody|Villin1 antibody

Application Details

Application Concentration* Species Validated Using**
Western blot 0.1-0.5μg/ml Human, Mouse, Rat AssaySolutio’s ECL kit
Immunohistochemistry(Paraffin-embedded Section) 0.5-1μg/ml Human, Mouse, Rat AssaySolutio’s IHC/ICC Detection kit

AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information

Anti- Villin antibody, ASA-B1973, Western blotting
All lanes: Anti Villin (ASA-B1973) at 0.5ug/ml
Lane 1: Rat Intestine Tissue Lysate at 50ug
Lane 2: Mouse Kidney Tissue Lysate at 50ug
Lane 3: RH35 Whole Cell Lysate at 40ug
Lane 4: HEPG2 Whole Cell Lysate at 40ug
Lane 5: MCF-7 Whole Cell Lysate at 40ug
Predicted bind size: 93KD
Observed bind size: 93KD
Anti- Villin antibody, ASA-B1973,IHC(P)
IHC(P): Mouse Intestine Tissue
Anti- Villin antibody, ASA-B1973,IHC(P)
IHC(P): Rat Intestine Tissue