Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| cryptochrome circadian clock 1 | Polyclonal | IgG | Rabbit | Human, Rat | WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the N-terminus of human Cryptochrome I (153-189aa FQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEK), different from the related mouse sequence by seven amino acids, and from the related rat sequence by six amino aci | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
CRY1 |
Protein |
Cryptochrome-1 |
Uniprot ID |
Q16526 |
Function |
Transcriptional repressor which forms a core component of the circadian clock. The circadian clock, an internal time- keeping system, regulates various physiological processes through the generation of approximately 24 hour circadian rhythms in gene expression, which are translated into rhythms in metabolism and behavior. It is derived from the Latin roots ‘circa’ (about) and ‘diem’ (day) and acts as an important regulator of a wide array of physiological functions including metabolism, sleep, body temperature, blood pressure, endocrine, immune, cardiovascular, and renal function. Consists of two major components: the central clock, residing in the suprachiasmatic nucleus (SCN) of the brain, and the peripheral clocks that are present in nearly every tissue and organ system. Both the central and peripheral clocks can be reset by environmental cues, also known as Zeitgebers (German for ‘timegivers’). The predominant Zeitgeber for the central clock is light, which is sensed by retina and signals directly to the SCN. The central clock entrains the peripheral clocks through neuronal and hormonal signals, body temperature and feeding-related cues, aligning all clocks with the external light/dark cycle. Circadian rhythms allow an organism to achieve temporal homeostasis with its environment at the molecular level by regulating gene expression to create a peak of protein expression once every 24 hours to control when a particular physiological process is most active with respect to the solar day. Transcription and translation of core clock components (CLOCK, NPAS2, ARNTL/BMAL1, ARNTL2/BMAL2, PER1, PER2, PER3, CRY1 and CRY2) plays a critical role in rhythm generation, whereas delays imposed by post-translational modifications (PTMs) are important for determining the period (tau) of the rhythms (tau refers to the period of a rhythm and is the length, in time, of one complete cycle). A diurnal rhythm is synchronized with the day/night cycle, while the ultradian and infradian rhythms have a period shorter and longer than 24 hours, respectively. Disruptions in the circadian rhythms contribute to the pathology of cardiovascular diseases, cancer, metabolic syndromes and aging. A transcription/translation feedback loop (TTFL) forms the core of the molecular circadian clock mechanism. Transcription factors, CLOCK or NPAS2 and ARNTL/BMAL1 or ARNTL2/BMAL2, form the positive limb of the feedback loop, act in the form of a heterodimer and activate the transcription of core clock genes and clock-controlled genes (involved in key metabolic processes), harboring E-box elements (5′-CACGTG-3′) within their promoters. The core clock genes: PER1/2/3 and CRY1/2 which are transcriptional repressors form the negative limb of the feedback loop and interact with the CLOCK |
Tissue Specificity |
|
Sub-cellular localization |
Cytoplasm. Nucleus. |
Sequence Similarities |
Belongs to the DNA photolyase class-1 family. |
Aliases |
Cry1 antibody|CRY1_HUMAN antibody|Cryptochrome 1 (photolyase like) antibody| Cryptochrome 1 antibody|Cryptochrome-1 antibody|PHLL1 antibody|Photolyase 1 antibody|Photolyase-like antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human, Rat | AssaySolutio’s ECL kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information

Anti- Cryptochrome I antibody, ASA-B0501, Western blotting
All lanes: Anti Cryptochrome I (ASA-B0501) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Rat Testis Tissue Lysate at 50ug
Lane 3: HELA Whole Cell Lysate at 40ug
Predicted bind size: 66KD
Observed bind size: 66KD
All lanes: Anti Cryptochrome I (ASA-B0501) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Rat Testis Tissue Lysate at 50ug
Lane 3: HELA Whole Cell Lysate at 40ug
Predicted bind size: 66KD
Observed bind size: 66KD





