Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| lectin, galactoside-binding, soluble, 9 | Polyclonal | IgG | Rabbit | Human, Rat | WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human galectin 9 (322-355aa DGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT), different from the related mouse sequence by eight amino acids, and from the related rat sequence by six amino acids. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
LGALS9 |
Protein |
Galectin-9 |
Uniprot ID |
O00182 |
Function |
|
Tissue Specificity |
|
Sub-cellular localization |
|
Sequence Similarities |
|
Aliases |
Ecalectin antibody|Gal-9 antibody|Galectin-9 antibody|galectin9 antibody|HOM HD 21 antibody|HOMHD21 antibody|HUAT antibody|Lectin galactoside binding soluble 9 antibody|LEG9_HUMAN antibody|LGAL S9 antibody|LGALS 9 antibody|Lgals9 antibody|LGALS9A antibody| MGC117375 antibody|MGC125973 antibody|MGC125974 antibody|Tumor antigen HOM-HD-21 antibody|Urate transporter/channel protein antibody |
Application Details
Anti- galectin 9 antibody, ASA-B0758, Western blotting
All lanes: Anti galectin 9 (ASA-B0758) at 0.5ug/ml
WB: Rat Gaster Tissue Lysate at 50ug
Predicted bind size: 40KD
Observed bind size: 36KD
All lanes: Anti galectin 9 (ASA-B0758) at 0.5ug/ml
WB: Rat Gaster Tissue Lysate at 50ug
Predicted bind size: 40KD
Observed bind size: 36KD
