Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| gap junction protein, alpha 3, 46kDa | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the N-terminus of human GJA3 (89-118aa TLIYLGHVLHIVRMEEKKKEREEEEQLKRE), different from the related mouse and rat sequences by four amino acids. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
GJA3 |
Protein |
Gap junction alpha-3 protein |
Uniprot ID |
Q9Y6H8 |
Function |
One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. |
Tissue Specificity |
|
Sub-cellular localization |
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction. |
Sequence Similarities |
|
Aliases |
CAE3 antibody|Connexin 46 antibody|Connexin-46 antibody|Connexin46 antibody|Cx46 antibody|CXA3_HUMAN antibody|CZP3 antibody|Gap junction alpha 3 protein antibody|Gap junction alpha-3 protein antibody|Gap junction protein, alpha 3, 46kD (connexin 46) antibody|Gap junction protein, alpha 3, 46kDa (connexin 46) antibody|Gap junction protein, alpha 3, 46kDa antibody|Gja3 antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human, Mouse, Rat | AssaySolutio’s ECL kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information
Anti- GJA3 antibody, ASA-B0786, Western blotting
All lanes: Anti GJA3 (ASA-B0786) at 0.5ug/ml
Lane 1: Rat Cardiac Muscle Tissue Lysate at 50ug
Lane 2: Rat Kidney Tissue Lysate at 50ug
Lane 3: Human Placenta Tissue Lysate at 50ug
Lane 4: NIH3T3 Whole Cell Lysate at 40ug
Predicted bind size: 47KD
Observed bind size: 55KD
All lanes: Anti GJA3 (ASA-B0786) at 0.5ug/ml
Lane 1: Rat Cardiac Muscle Tissue Lysate at 50ug
Lane 2: Rat Kidney Tissue Lysate at 50ug
Lane 3: Human Placenta Tissue Lysate at 50ug
Lane 4: NIH3T3 Whole Cell Lysate at 40ug
Predicted bind size: 47KD
Observed bind size: 55KD
