Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| gremlin 1 | Polyclonal | IgG | Rabbit | Human, Rat | WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human Gremlin 1 (151-184aa TMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD), identical to the related mouse and rat sequences. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
GREM1 |
Protein |
Gremlin-1 |
Uniprot ID |
O60565 |
Function |
|
Tissue Specificity |
|
Sub-cellular localization |
|
Sequence Similarities |
|
Aliases |
BMP antagonist 1 antibody|Cell proliferation inducing gene 2 protein antibody|Cell proliferation-inducing gene 2 protein antibody| CKTSF1B1 antibody|Cysteine knot superfamily 1 antibody|Cysteine knot superfamily 1, BMP antagonist 1 antibody|Cysteine knot superfamily BMP antagonist 1 antibody|DAN domain family member 2 antibody|DAND2 antibody|Down regulated in Mos-transformed cells protein antibody| Down-regulated in Mos-transformed cells protein antibody|DRM antibody|grem1 antibody|GREM1_HUMAN antibody|Gremlin 1 like protein antibody| Gremlin 1, cysteine knot superfamily, homolog antibody|GREMLIN antibody|Gremlin-1 antibody| Gremlin1 antibody| IHG-2 antibody| IHG2 antibody|Increased in high glucose 2 antibody| Increased in high glucose protein 2 antibody|PIG2 antibody| Proliferation inducing gene 2 antibody|proliferation inducing gene 2 protein antibody |
Application Details
Anti- Gremlin 1 antibody, ASA-B0815, Western blotting
All lanes: Anti Gremlin 1 (ASA-B0815) at 0.5ug/ml
WB: Rat Pancreas Tissue Lysate at 50ug
Predicted bind size: 23KD
Observed bind size: 23KD
All lanes: Anti Gremlin 1 (ASA-B0815) at 0.5ug/ml
WB: Rat Pancreas Tissue Lysate at 50ug
Predicted bind size: 23KD
Observed bind size: 23KD
