Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| histone deacetylase 6 | Polyclonal | IgG | Rabbit | Human, Rat | WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the N-terminus of human HDAC6 (137-169aa EKEELMLVHSLEYIDLMETTQYMNEGELRVLAD), different from the related mouse sequence by one amino acid. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
HDAC6 |
Protein |
Histone deacetylase 6 |
Uniprot ID |
Q9UBN7 |
Function |
|
Tissue Specificity |
|
Sub-cellular localization |
|
Sequence Similarities |
|
Aliases |
FLJ16239 antibody|HD 6 antibody|HD6 antibody|HDAC 6 antibody|HDAC6 antibody|HDAC6_HUMAN antibody|Histone deacetylase 6 (HD6) antibody| Histone deacetylase 6 antibody|JM 21 antibody|JM21 antibody|KIAA0901 antibody|OTTHUMP00000032398 antibody| OTTHUMP00000197663 antibody |
Application Details
Anti- HDAC6 antibody, ASA-B0846, Western blotting
All lanes: Anti HDAC6 (ASA-B0846) at 0.5ug/ml
Lane 1: Rat Skeletal Muscle Tissue Lysate at 50ug
Lane 2: COLO320 Whole Cell Lysate at 40ug
Predicted bind size: 160KD
Observed bind size: 160KD
All lanes: Anti HDAC6 (ASA-B0846) at 0.5ug/ml
Lane 1: Rat Skeletal Muscle Tissue Lysate at 50ug
Lane 2: COLO320 Whole Cell Lysate at 40ug
Predicted bind size: 160KD
Observed bind size: 160KD
