Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| keratocan | Polyclonal | IgG | Rabbit | Human, Mouse | WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human Keratocan (77-109aa YLQNNLIETIPEKPFENATQLRWINLNKNKITN), different from the related mouse sequence by two amino acids. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
KERA |
Protein |
Keratocan |
Uniprot ID |
O60938 |
Function |
|
Tissue Specificity |
|
Sub-cellular localization |
|
Sequence Similarities |
|
Aliases |
CNA2 antibody|KERA antibody|KERA_HUMAN antibody|Keratan sulfate proteoglycan keratocan antibody|Keratocan antibody|KTN antibody| SLRR2B antibody |
Application Details
Anti- Keratocan antibody, ASA-B1116, Western blotting
All lanes: Anti Keratocan (ASA-B1116) at 0.5ug/ml
Lane 1: Mouse Testis Whole Cell Lysate at 40ug
Lane 2: Mouse Skeletal Muscle Whole Cell Lysate at 40ug
Lane 3: MCF-7 Whole Cell Lysate at 40ug
Lane 4: A549 Whole Cell Lysate at 40ug
Predicted bind size: 40KD
Observed bind size: 50KD
All lanes: Anti Keratocan (ASA-B1116) at 0.5ug/ml
Lane 1: Mouse Testis Whole Cell Lysate at 40ug
Lane 2: Mouse Skeletal Muscle Whole Cell Lysate at 40ug
Lane 3: MCF-7 Whole Cell Lysate at 40ug
Lane 4: A549 Whole Cell Lysate at 40ug
Predicted bind size: 40KD
Observed bind size: 50KD
