Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| matrix metallopeptidase 12 (macrophage elastase) | Polyclonal | IgG | Rabbit | Mouse | ELISA, WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of mouse MMP12 (432-466aa KIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLK), different from the related human sequence by thirteen amino acids, and from the related rat sequence by three amino acids. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
MMP12 |
Protein |
Macrophage metalloelastase |
Uniprot ID |
P34960 |
Function |
|
Tissue Specificity |
|
Sub-cellular localization |
|
Sequence Similarities |
|
Aliases |
EC 3.4.24.65 antibody|HME antibody|Macrophage elastase antibody|Macrophage metalloelastase antibody|Macrophage metaloelastase antibody|Matrix metallopeptidase 12 (macrophage elastase) antibody|Matrix metalloprotease 12 antibody|Matrix metalloproteinase-12 antibody| ME antibody|MGC138506 antibody|MME antibody|MMP 12 antibody|MMP-12 antibody|Mmp12 antibody|MMP12_HUMAN antibody |
Application Details
Anti- ASA-B1286 antibody, PBMMP12, Western blotting
All lanes: Anti MMP12 (ASA-B1286) at 0.5ug/ml
WB: HEPA Whole Cell Lysate at 40ug
Predicted bind size: 55KD
Observed bind size: 55KD
All lanes: Anti MMP12 (ASA-B1286) at 0.5ug/ml
WB: HEPA Whole Cell Lysate at 40ug
Predicted bind size: 55KD
Observed bind size: 55KD
