NQO1 Antibody

$365.00

In stock

SKU: ASA-B1408 Category:

Description

Overview

Long Name

Antibody Type

Antibody Isotype

Host

Species Reactivity

Validated Applications

Purification 

NAD(P)H dehydrogenase, quinone 1 Polyclonal IgG Rabbit Human, Rat WB Immunogen affinity purified.

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human NQO1 (242-274aa EVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK), different from the related mouse and rat sequences by five amino acids.

Properties

Form

Lyophilized

Size

100 µg/vial

Contents

Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request.

Concentration

Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration).

Storage

At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

Additional Information Regarding the Antigen

Gene

NQO1

Protein

NAD(P)H dehydrogenase [quinone] 1

Uniprot ID

P15559

Function

The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinons involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis.

Tissue Specificity

Sub-cellular localization

Cytoplasm.

Sequence Similarities

Belongs to the NAD(P)H dehydrogenase (quinone) family.

Aliases

Azoreductase antibody|Cytochrome b 5 reductase antibody|DHQU antibody| DIA 4 antibody|DIA4 antibody|Diaphorase (NADH/NADPH) (cytochrome b 5 reductase) antibody|Diaphorase (NADH/NADPH) antibody|Diaphorase 4 antibody|Dioxin inducible 1 antibody|DT diaphorase antibody|DT-diaphorase antibody|DTD antibody|Menadione reductase antibody|NAD(P)H dehydrogenase [quinone] 1 antibody|NAD(P)H dehydrogenase quinone 1 antibody|NAD(P)H menadione oxidoreductase 1 dioxin inducible antibody| NAD(P)H: menadione oxidoreductase 1 dioxin inducible 1 antibody| NAD(P) H:menadione oxidoreductase 1 antibody|NAD(P)H:Quinone acceptor oxidoreductase type 1 antibody|NAD(P)H:quinone oxidoreductase 1 antibody| NAD(P)H:quinone oxireductase antibody|NMOR 1 antibody|NMOR I antibody| NMOR1 antibody|NMORI antibody|NQO 1 antibody|NQO1 antibody|NQO1_HUMAN antibody|Phylloquinone reductase antibody| QR 1 antibody|QR1 antibody|Quinone reductase 1 antibody

Application Details

Application Concentration* Species Validated Using**
Western blot 0.1-0.5μg/ml Human, Rat AssaySolutio’s ECL kit

AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information

Anti- NQO1 antibody, ASA-B1408, Western blotting
All lanes: Anti NQO1 (ASA-B1408) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: Rat Lung Tissue Lysate at 50ug
Lane 3: HELA Whole Cell Lysate at 40ug
Lane 4: A549 Whole Cell Lysate at 40ug
Lane 5: MM231 Whole Cell Lysate at 40ug
Lane 6: SW620 Whole Cell Lysate at 40ug
Lane 7: 22RV1 Whole Cell Lysate at 40ug
Predicted bind size: 31KD
Observed bind size: 31KD