Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| runt-related transcription factor 2 | Polyclonal | IgG | Rabbit | Human | WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence in the middle region of human RUNX2(244-278aa DRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFN), identical to the related mouse sequence. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
RUNX2 |
Protein |
Runt-related transcription factor 2 |
Uniprot ID |
Q13950 |
Function |
Transcription factor involved in osteoblastic differentiation and skeletal morphogenesis. Essential for the maturation of osteoblasts and both intramembranous and endochondral ossification. CBF binds to the core site, 5′- PYGPYGGT-3′, of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, osteocalcin, osteopontin, bone sialoprotein, alpha 1(I) collagen, LCK, IL-3 and GM-CSF promoters. In osteoblasts, supports transcription activation: synergizes with SPEN/MINT to enhance FGFR2-mediated activation of the osteocalcin FGF-responsive element (OCFRE) (By similarity). Inhibits KAT6B-dependent transcriptional activation. |
Tissue Specificity |
Specifically expressed in osteoblasts. |
Sub-cellular localization |
Nucleus. |
Sequence Similarities |
Contains 1 Runt domain. |
Aliases |
Acute myeloid leukemia 3 protein antibody|Alpha subunit 1 antibody|AML3 antibody|CBF alpha 1 antibody|CBF-alpha-1 antibody|CBFA1 antibody|CCD antibody|CCD1 antibody|Cleidocranial dysplasia 1 antibody|Core binding factor antibody|Core binding factor runt domain alpha subunit 1 antibody|Core binding factor subunit alpha 1 antibody|Core-binding factor subunit alpha-1 antibody|MGC120022 antibody|MGC120023 antibody|Oncogene AML 3 antibody|Oncogene AML-3 antibody|OSF 2 antibody|OSF-2 antibody|OSF2 antibody|Osteoblast specific transcription factor 2 antibody|Osteoblast-specific transcription factor 2 antibody|OTTHUMP00000016533 antibody|PEA2 alpha A antibody|PEA2-alpha A antibody|PEA2aA antibody|PEBP2 alpha A antibody|PEBP2-alpha A antibody|PEBP2A1 antibody|PEBP2A2 antibody|PEBP2aA antibody|PEBP2aA antibody|PEBP2aA1 antibody|Polyomavirus enhancer binding protein 2 alpha A subunit antibody|Polyomavirus enhancer-binding protein 2 alpha A subunit antibody|Runt domain antibody|Runt related transcription factor 2 antibody|Runt-related transcription factor 2 antibody|RUNX2 antibody|RUNX2_HUMAN antibody|SL3 3 enhancer factor 1 alpha A subunit antibody|SL3-3 enhancer factor 1 alpha A subunit antibody|SL3/AKV core binding factor alpha A subunit antibody|SL3/AKV core-binding factor alpha A subunit antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human | AssaySolutio’s ECL kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information

Anti-RUNX2 antibody, ASA-B1640–1.jpg
All lanes: Anti RUNX2 (ASA-B1640) at 0.5ug/ml
WB: Recombinant Human RUNX2 Protein 0.5ng
Predicted bind size: 50KD
Observed bind size: 50KD
All lanes: Anti RUNX2 (ASA-B1640) at 0.5ug/ml
WB: Recombinant Human RUNX2 Protein 0.5ng
Predicted bind size: 50KD
Observed bind size: 50KD

Anti-RUNX2 antibody, ASA-B1640–2.jpg
All lanes: Anti RUNX2 (ASA-B1640) at 0.5ug/ml
Lane 1: HELA Whole Cell Lysate at 40ug
Lane 2: A431 Whole Cell Lysate at 40ug
Lane 3: K562 Whole Cell Lysate at 40ug
Lane 4: JURKAT Whole Cell Lysate at 40ug
Predicted bind size: 56KD
Observed bind size: 62KD
All lanes: Anti RUNX2 (ASA-B1640) at 0.5ug/ml
Lane 1: HELA Whole Cell Lysate at 40ug
Lane 2: A431 Whole Cell Lysate at 40ug
Lane 3: K562 Whole Cell Lysate at 40ug
Lane 4: JURKAT Whole Cell Lysate at 40ug
Predicted bind size: 56KD
Observed bind size: 62KD





