Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| secreted and transmembrane 1 | Polyclonal | IgG | Rabbit | Mouse | WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of mouse SECTM1 (118-152aa KLHGFQAEFKNFNLTVNAADRQKTEDLPVTKVPDK). | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
SECTM1 |
Protein |
Secreted and transmembrane protein 1b |
Uniprot ID |
Q9JL59 |
Function |
|
Tissue Specificity |
|
Sub-cellular localization |
|
Sequence Similarities |
|
Aliases |
K12 antibody|K12 protein antibody|Protein K-12 antibody|Protein K12 antibody|SCTM1_HUMAN antibody|Secreted and transmembrane 1 antibody|Secreted and transmembrane protein 1 antibody|SECTM 1 antibody|SECTM1 antibody|Type 1a transmembrane protein antibody |
Application Details
Anti- SECTM1 antibody, ASA-B1662, Western blotting
All lanes: Anti SECTM1 (ASA-B1662) at 0.5ug/ml
WB : HEPA Whole Cell Lysate at 40ug
Predicted bind size: 23KD
Observed bind size: 23KD
All lanes: Anti SECTM1 (ASA-B1662) at 0.5ug/ml
WB : HEPA Whole Cell Lysate at 40ug
Predicted bind size: 23KD
Observed bind size: 23KD
