Stathmin 1 Antibody

$365.00

In stock

SKU: ASA-B1803 Category:

Description

Overview

Long Name

Antibody Type

Antibody Isotype

Host

Species Reactivity

Validated Applications

Purification 

stathmin 1 Polyclonal IgG Rabbit Human, Mouse, Rat IHC-P, WB Immunogen affinity purified.

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human Stathmin 1 (2-34aa ASSDIQVKELEKRASGQAFELILSPRSKESVPE), different from the related mouse sequence by one amino acid, and identical to the related rat sequence.

Properties

Form

Lyophilized

Size

100 µg/vial

Contents

Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request.

Concentration

Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration).

Storage

At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

Additional Information Regarding the Antigen

Gene

STMN1

Protein

Stathmin

Uniprot ID

P16949

Function

Involved in the regulation of the microtubule (MT) filament system by destabilizing microtubules. Prevents assembly and promotes disassembly of microtubules. Phosphorylation at Ser- 16 may be required for axon formation during neurogenesis. Involved in the control of the learned and innate fear (By similarity).

Tissue Specificity

Ubiquitous. Expression is strongest in fetal and adult brain, spinal cord, and cerebellum, followed by thymus, bone marrow, testis, and fetal liver. Expression is intermediate in colon, ovary, placenta, uterus, and trachea, and is readily detected at substantially lower levels in all other tissues examined. Lowest expression is found in adult liver. Present in much greater abundance in cells from patients with acute leukemia of different subtypes than in normal peripheral blood lymphocytes, non-leukemic proliferating lymphoid cells, bone marrow cells, or cells from patients with chronic lymphoid or myeloid leukemia.

Sub-cellular localization

Cytoplasm, cytoskeleton.

Sequence Similarities

Belongs to the stathmin family.

Aliases

C1orf215 antibody|Lag antibody|LAP 18 antibody|LAP18 antibody|Leukemia associated phosphoprotein p18 antibody|Leukemia-associated phosphoprotein p18 antibody|Metablastin antibody|Oncoprotein 18 antibody|OP 18 antibody|OP18 antibody|p18 antibody|p19 antibody| Phosphoprotein 19 antibody|Phosphoprotein p19 antibody|PP17 antibody|PP19 antibody|PR22 antibody|Pr22 protein antibody| Prosolin antibody|Protein Pr22 antibody|SMN antibody| Stathmin antibody| Stathmin1 antibody|Stathmin-1 antibody|STMN 1 antibody|STMN1 antibody|STMN1_HUMAN antibody

Application Details

Application Concentration* Species Validated Using**
Western blot 0.1-0.5μg/ml Human, Mouse AssaySolutio’s ECL kit
Immunohistochemistry(Paraffin-embedded Section) 0.5-1μg/ml Human, Mouse, Rat AssaySolutio’s IHC/ICC Detection kit

AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information

Anti- Stathmin 1 antibody, ASA-B1803, Western blotting
All lanes: Anti Stathmin 1 (ASA-B1803) at 0.5ug/ml
Lane 1: Mouse Brain Tissue Lysate at 50ug
Lane 2: Mouse Testis Tissue Lysate at 50ug
Lane 3: MM231 Whole Cell Lysate at 40ug
Lane 4: MCF-7 Whole Cell Lysate at 40ug
Predicted bind size: 17KD
Observed bind size: 17KD
nti- Stathmin 1 antibody, ASA-B1803, IHC(P)
IHC(P): Mouse Testis Tissue
nti- Stathmin 1 antibody, ASA-B1803, IHC(P)
IHC(P): Rat Brain Tissue