Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| angiotensin II receptor, type 2 | Polyclonal | IgG | Rabbit | Human, Rat | WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human AGTR2 (333-363aa FRVPITWLQGKRESMSCRKSSSLREMETFVS), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
AGTR2 |
Protein |
Type-2 angiotensin II receptor |
Uniprot ID |
P50052 |
Function |
Receptor for angiotensin II. Cooperates with MTUS1 to inhibit ERK2 activation and cell proliferation. |
Tissue Specificity |
In adult, highly expressed in myometrium with lower levels in adrenal gland and fallopian tube. Expressed in the cerebellum. Very highly expressed in fetal kidney and intestine. |
Sub-cellular localization |
Cell membrane; Multi-pass membrane protein. |
Sequence Similarities |
Belongs to the G-protein coupled receptor 1 family. |
Aliases |
AGTR 2 antibody|Agtr2 antibody|AGTR2_HUMAN antibody|angiotensin II receptor type 2 antibody|Angiotensin II type-2 receptor antibody|Angiotensin receptor 2 antibody|AT 2 antibody|AT2 antibody|ATGR 2 antibody|ATGR2 antibody|MRX 88 antibody|MRX88 antibody|Type 2 angiotensin II receptor antibody|Type-2 angiotensin II receptor antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human, Rat | AssaySolutio’s ECL kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information.
Anti- AGTR2 antibody, ASA-B0051, Western blotting
All lanes: Anti AGTR2 (ASA-B0051) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: HELA Whole Cell Lysate at 40ug
Predicted band size: 47KD
Observed band size: 47KD
All lanes: Anti AGTR2 (ASA-B0051) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: HELA Whole Cell Lysate at 40ug
Predicted band size: 47KD
Observed band size: 47KD
