Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| aldehyde dehydrogenase 2 family (mitochondrial) | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH2 (18-48aa SAAATQAVPAPNQQPEVFCNQIFINNEWHDA), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
ALDH2 |
Protein |
Aldehyde dehydrogenase, mitochondrial |
Uniprot ID |
P05091 |
Function |
|
Tissue Specificity |
|
Sub-cellular localization |
Mitochondrion matrix. |
Sequence Similarities |
Belongs to the aldehyde dehydrogenase family. |
Aliases |
Acetaldehyde dehydrogenase 2 antibody|Aldehyde dehydrogenase 2 family (mitochondrial) antibody|Aldehyde dehydrogenase 2 family antibody|Aldehyde dehydrogenase mitochondrial antibody|Aldehyde dehydrogenase, mitochondrial antibody|ALDH 2 antibody|ALDH class 2 antibody|ALDH E2 antibody|ALDH-E2 antibody|Aldh2 antibody|ALDH2_HUMAN antibody|ALDHI antibody|ALDM antibody|Liver mitochondrial ALDH antibody|MGC1806 antibody|Mitochondrial aldehyde dehydrogenase 2 antibody|MS767 antibody|Nucleus encoded mitochondrial aldehyde dehydrogenase 2 antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Mouse, Rat Human | AssaySolutio’s ECL kit |
| Immunohistochemistry(Paraffin-embedded Section) | 0.5-1μg/ml | Human, Rat Human | AssaySolutio’s IHC/ICC Detection kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information
Anti- ALDH2 antibody, ASA-B0063, Western blotting
All lanes: Anti ALDH2 (ASA-B0063) at 0.5ug/ml
Lane 1: Rat Kidney Tissue Lysate at 50ug
Lane 2: Mouse Kidney Tissue Lysate at 50ug
Predicted banand
All lanes: Anti ALDH2 (ASA-B0063) at 0.5ug/ml
Lane 1: Rat Kidney Tissue Lysate at 50ug
Lane 2: Mouse Kidney Tissue Lysate at 50ug
Predicted banand
size:
56KD
Anti- ALDH2 antibody, ASA-B0063, IHC(P)
Rat Liver Tissue
Rat Liver Tissue
Anti- ALDH2 antibody, ASA-B0063, IHC(P)
Human Kidney Cancer Tissue
Human Kidney Cancer Tissue
