APH1a Antibody

$365.00

In stock

SKU: ASA-B0116 Category:

Description

Overview

Long Name

Antibody Type

Antibody Isotype

Host

Species Reactivity

Validated Applications

Purification 

APH1A gamma secretase subunit Polyclonal IgG Rabbit Human, Mouse WB Immunogen affinity purified.

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human APH1a (236-265aa LRSIQRSLLCRRQEDSRVMVYSALRIPPED), different from the related mouse sequence by one amino acid.

Properties

Form

Lyophilized

Size

100 µg/vial

Contents

Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request.

Concentration

Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration).

Storage

At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

Additional Information Regarding the Antigen

Gene

APH1A

Protein

Gamma-secretase subunit APH-1

Uniprot ID

Q96BI3

Function

Essential subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral proteins such as Notch receptors and APP (beta-amyloid precursor protein). It probably represents a stabilizing cofactor for the presenilin homodimer that promotes the formation of a stable complex.

Tissue Specificity

Widely expressed. Expressed in leukocytes, lung, placenta, small intestine, liver, kidney, spleen thymus, skeletal muscle, heart and brain. Isoform 1 and isoform 2 are nearly expressed at the same level.

Sub-cellular localization

Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus, Golgi stack membrane; Multi- pass membrane protein. Note: Predominantly located in the endoplasmic reticulum and in the cis-Golgi.

Sequence Similarities

Belongs to the APH-1 family.

Aliases

6530402N02Rik antibody|AL138795.3 antibody|Anterior Pharynx Defective 1 antibody|Anterior pharynx defective 1 homolog A antibody|APH 1A antibody|Aph 1alpha antibody|APH-1a antibody| Aph-1alpha antibody|Aph1a antibody|APH1A gamma secretase subunit antibody|APH1A_HUMAN antibody|CGI 78 antibody| CGI78 antibody|Gamma secretase subunit APH 1A antibody|Gamma Secretase Subunit APH1a antibody|Gamma-secretase subunit APH-1A antibody|Likely ortholog of C. elegans anterior pharynx defective 1A antibody|Presenilin Stabilization Factor antibody| Presenilin-stabilization factor antibody|PSF antibody| UNQ579/PRO1141 antibody

Application Details

Application Concentration* Species Validated Using**
Western blot 0.1-0.5μg/ml Human, Mouse AssaySolutio’s ECL kit

AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information

Anti- APH1a
Anti- APH1a antibody, ASA-B0116, Western blotting
All lanes: Anti APH1a (ASA-B0116) at 0.5ug/ml
Lane 1: Mouse Lung Tissue Lysate at 50ug
Lane 2: Mouse Liver Tissue Lysate at 50ug
Lane 3: SW620 Whole Cell Lysate at 40ug
Lane 4: SMMC Whole Cell Lysate at 40ug
Lane 5: Human Placenta Tissue Lysate at 50ug
Predicted band size: 29KD
Observed band size: 29KD