B-cell Activating Factor Receptor Human Recombinant ( BAFF R Human )

Price range: $192.50 through $1,455.30

Novatein Biosciences provides B-cell Activating Factor Receptor Human Recombinant ( BAFF R Human ) also known as B cell-activating factor receptor, BAFF-R, CD268, MGC138235, TNFRSF13C for your R&D

SKU: PT_39977 Category:

Description

Data Sheet

Amino acid sequence MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPG.
Biological Activity Determined by its ability to block BAFF induced mouse splenocyte survival. The expected ED50 for this effect is 1.0-5.0 ug/ml in the presence of 1.0ug/ml of human soluble BAFF.
Description B Lymphocyte Stimulator Receptor Human Recombinant extracellular produced in E.Coli is a single, non-glycosylated polypeptide chain containing 76 amino acids and having a molecular mass of 7.7 kDa.The BAFF-R is purified by proprietary chromatographic techniques.
Expression host Escherichia Coli.
Formulation Lyophilized from a 0.2m filtered concentrated (1.0mg/ml) solution in 20mM PB, pH 8.0, 500mM NaCl.
Protein Background B cell-activating factor (BAFF) enhances B-cell survival in vitro and is a regulator of the peripheral B-cell population. Overexpression of Baff in mice results in mature B-cell hyperplasia and symptoms of systemic lupus erythematosus (SLE). Also, some SLE patients have increased levels of BAFF in serum. Therefore, it has been proposed that abnormally high levels of BAFF may contribute to the pathogenesis of autoimmune diseases by enhancing the survival of autoreactive B cells. The protein encoded by this gene is a receptor for BAFF and is a type III transmembrane protein containing a single extracellular cysteine-rich domain. It is thought that this receptor is the principal receptor required for BAFF-mediated mature B-cell survival.
Purity Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Reagent Appearance Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility It is recommended to reconstitute the lyophilized B Lymphocyte Stimulator Receptor Recombinant in sterile 18M-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.
Stability Lyophilized BAFF-R although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution B Lymphocyte Stimulator Receptor should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles.
Synonyms TNFRSF13C, CD268, BAFF-R, MGC138235, B cell-activating factor receptor.

Additional information

Size

50ug, 10ug, 1mg