B-type Natriuretic Peptide Human Recombinant ( BNP Human )

Price range: $467.50 through $1,617.00

Novatein Biosciences provides B-type Natriuretic Peptide Human Recombinant ( BNP Human ) also known as BNP, B-type Natriuretic Peptide, Natriuretic Peptide Precursor B, NPPB for your R&D

SKU: PT_41632 Category:

Description

Data Sheet

Amino acid sequence SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.
Description B-type Natriuretic Peptide Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. NPPB is purified by proprietary chromatographic techniques.
Expression host Escherichia Coli.
Formulation Natriuretic Peptide Precursor B was lyophilized from 0.4ml PBS buffer containing 20mM phosphate buffer and 0.6mM sodium chloride.
Protein Background Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body’s salt and water balance. Improves heart function.
Purity Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Reagent Appearance Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility It is recommended to reconstitute the lyophilized B-type Natriuretic Peptide in sterile 18M-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.
Stability Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution NPPB should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Synonyms NPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide.

Additional information

Size

100mg, 25mg, 10mg