Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| BMI1 proto-oncogene, polycomb ring finger | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence in the middle region of human Bmi1(135-165aa IEFFDQNRLDRKVNKDKEKSKEEVNDKRYLR), different from the related mouse sequence by four amino acids. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
BMI1 |
Protein |
Polycomb complex protein BMI-1 |
Uniprot ID |
P35226 |
Function |
Component of a Polycomb group (PcG) multiprotein PRC1- like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A ‘Lys-119’, rendering chromatin heritably changed in its expressibility. In the PRC1 complex, it is required to stimulate the E3 ubiquitin-protein ligase activity of RNF2/RING2. |
Tissue Specificity |
|
Sub-cellular localization |
Nucleus. Cytoplasm. |
Sequence Similarities |
Contains 1 RING-type zinc finger. |
Aliases |
B lymphoma Mo MLV insertion region (mouse) antibody|B lymphoma Mo MLV insertion region 1 homolog antibody|Bmi 1 antibody|BMI1 antibody|BMI1 polycomb ring finger oncogene antibody|BMI1_HUMAN antibody|Flvi 2/bmi 1 antibody|FLVI2/BMI1 antibody|MGC12685 antibody|Murine leukemia viral (bmi 1) oncogene homolog antibody|Oncogene BMI 1 antibody|PCGF 4 antibody|PCGF4 antibody|Polycomb complex protein BMI 1 antibody|Polycomb complex protein BMI-1 antibody|Polycomb group protein Bmi1 antibody|Polycomb group ring finger 4 antibody|Polycomb group RING finger protein 4 antibody|RING finger protein 51 antibody|RNF 51 antibody|RNF51 antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human, Mouse, Rat | AssaySolutio’s ECL kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information

Anti-Bmi1 antibody, ASA-B0233–1.jpg
All lanes: Anti BMI1 (ASA-B0233) at 0.5ug/ml
WB: Recombinant Human BMI1 Protein 0.5ng
Predicted bind size: 37KD
Observed bind size: 37KD
All lanes: Anti BMI1 (ASA-B0233) at 0.5ug/ml
WB: Recombinant Human BMI1 Protein 0.5ng
Predicted bind size: 37KD
Observed bind size: 37KD

Anti-Bmi1 antibody, ASA-B0233–2.jpg
All lanes: Anti BMI1 (ASA-B0233) at 0.5ug/ml
Lane 1: Rat Spleen Tissue Lysate at 50ug
Lane 2: HT1080 Whole Cell Lysate at 40ug
Lane 3: HELA Whole Cell Lysate at 40ug
Predicted bind size: 37KD
Observed bind size: 37KD
All lanes: Anti BMI1 (ASA-B0233) at 0.5ug/ml
Lane 1: Rat Spleen Tissue Lysate at 50ug
Lane 2: HT1080 Whole Cell Lysate at 40ug
Lane 3: HELA Whole Cell Lysate at 40ug
Predicted bind size: 37KD
Observed bind size: 37KD





