Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| integrin, beta 2(complement component 3 receptor 3 and 4 subunit) | Polyclonal | IgG | Rabbit | Human | IHC-P, WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the N-terminus of human CD18(24-58aa, ECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPD), different from the related mouse sequence by five amino acids. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Thimerosal and 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
ITGB2 |
Protein |
Integrin beta-2 |
Uniprot ID |
P05107 |
Function |
Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. Integrins alpha-M/beta-2 and alpha-X/beta-2 are receptors for the iC3b fragment of the third complement component and for fibrinogen. Integrin alpha-X/beta-2 recognizes the sequence G-P-R in fibrinogen alpha-chain. Integrin alpha-M/beta-2 recognizes P1 and P2 peptides of fibrinogen gamma chain. Integrin alpha-M/beta-2 is also a receptor for factor X. Integrin alpha- D/beta-2 is a receptor for ICAM3 and VCAM1. Triggers neutrophil transmigration during lung injury through PTK2B/PYK2-mediated activation. |
Tissue Specificity |
|
Sub-cellular localization |
Membrane; Single-pass type I membrane protein. |
Sequence Similarities |
Belongs to the integrin beta chain family. |
Aliases |
95 subunit beta antibody|CD 18 antibody|CD18 antibody|Cell surface adhesion glycoprotein LFA 1/CR3/P150,959 beta subunit precursor) antibody|Cell surface adhesion glycoproteins LFA 1/CR3/p150,95 subunit beta antibody|Cell surface adhesion glycoproteins LFA-1/CR3/p150 antibody|Complement receptor C3 beta subunit antibody|Complement receptor C3 subunit beta antibody|Integrin beta 2 antibody|Integrin beta chain beta 2 antibody|Integrin beta-2 antibody|Integrin, beta 2(complement component 3 receptor 3 and 4 subunit) antibody|ITB2_HUMAN antibody|ITGB2 antibody|LAD antibody|LCAMB antibody|Leukocyte associated antigens CD18/11A, CD18/11B, CD18/11C antibody|Leukocyte cell adhesion molecule CD18 antibody|LFA 1 antibody|LFA1 antibody|Lymphocyte function associated antigen 1 antibody|MAC 1 antibody|MAC1 antibody|MF17 antibody|MFI7 antibody|OTTHUMP00000115278 antibody|OTTHUMP00000115279 antibody|OTTHUMP00000115280 antibody|OTTHUMP00000115281 antibody|OTTHUMP00000115282 antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human | AssaySolutio’s ECL kit |
| Immunohistochemistry(Paraffin-embedded Section) | 0.5-1μg/ml | Human | AssaySolutio’s IHC/ICC Detection kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information

Anti-CD18 antibody, ASA-B0358, IHC(P)
IHC(P): Human Uroepithelium Cancer Tissue
IHC(P): Human Uroepithelium Cancer Tissue

Anti-CD18 antibody, ASA-B0358, Western blotting
All lanes: Anti CD18 (ASA-B0358) at 0.5ug/ml
Lane 1: HELA Whole Cell Lysate at 40ug
Lane 2: JURKAT Whole Cell Lysate at 40ug
Lane 3: HT1080 Whole Cell Lysate at 40ug
Predicted bind size: 85KD
Observed bind size: 85KD
All lanes: Anti CD18 (ASA-B0358) at 0.5ug/ml
Lane 1: HELA Whole Cell Lysate at 40ug
Lane 2: JURKAT Whole Cell Lysate at 40ug
Lane 3: HT1080 Whole Cell Lysate at 40ug
Predicted bind size: 85KD
Observed bind size: 85KD





