CD18 Antibody

$330.00

In stock

SKU: ASA-B0358 Category:

Description

Overview

Long Name

Antibody Type

Antibody Isotype

Host

Species Reactivity

Validated Applications

Purification 

integrin, beta 2(complement component 3 receptor 3 and 4 subunit) Polyclonal IgG Rabbit Human IHC-P, WB Immunogen affinity purified.

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human CD18(24-58aa, ECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPD), different from the related mouse sequence by five amino acids.

Properties

Form

Lyophilized

Size

100 µg/vial

Contents

Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Thimerosal and 0.05 mg NaN3. *carrier free antibody available upon request.

Concentration

Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration).

Storage

At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

Additional Information Regarding the Antigen

Gene

ITGB2

Protein

Integrin beta-2

Uniprot ID

P05107

Function

Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. Integrins alpha-M/beta-2 and alpha-X/beta-2 are receptors for the iC3b fragment of the third complement component and for fibrinogen. Integrin alpha-X/beta-2 recognizes the sequence G-P-R in fibrinogen alpha-chain. Integrin alpha-M/beta-2 recognizes P1 and P2 peptides of fibrinogen gamma chain. Integrin alpha-M/beta-2 is also a receptor for factor X. Integrin alpha- D/beta-2 is a receptor for ICAM3 and VCAM1. Triggers neutrophil transmigration during lung injury through PTK2B/PYK2-mediated activation.

Tissue Specificity

Sub-cellular localization

Membrane; Single-pass type I membrane protein.

Sequence Similarities

Belongs to the integrin beta chain family.

Aliases

95 subunit beta antibody|CD 18 antibody|CD18 antibody|Cell surface adhesion glycoprotein LFA 1/CR3/P150,959 beta subunit precursor) antibody|Cell surface adhesion glycoproteins LFA 1/CR3/p150,95 subunit beta antibody|Cell surface adhesion glycoproteins LFA-1/CR3/p150 antibody|Complement receptor C3 beta subunit antibody|Complement receptor C3 subunit beta antibody|Integrin beta 2 antibody|Integrin beta chain beta 2 antibody|Integrin beta-2 antibody|Integrin, beta 2(complement component 3 receptor 3 and 4 subunit) antibody|ITB2_HUMAN antibody|ITGB2 antibody|LAD antibody|LCAMB antibody|Leukocyte associated antigens CD18/11A, CD18/11B, CD18/11C antibody|Leukocyte cell adhesion molecule CD18 antibody|LFA 1 antibody|LFA1 antibody|Lymphocyte function associated antigen 1 antibody|MAC 1 antibody|MAC1 antibody|MF17 antibody|MFI7 antibody|OTTHUMP00000115278 antibody|OTTHUMP00000115279 antibody|OTTHUMP00000115280 antibody|OTTHUMP00000115281 antibody|OTTHUMP00000115282 antibody

Application Details

Application Concentration* Species Validated Using**
Western blot 0.1-0.5μg/ml Human AssaySolutio’s ECL kit
Immunohistochemistry(Paraffin-embedded Section) 0.5-1μg/ml Human AssaySolutio’s IHC/ICC Detection kit

AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information

Anti-CD18 antibody, ASA-B0358, IHC(P)
IHC(P): Human Uroepithelium Cancer Tissue
Anti-CD18 antibody, ASA-B0358, Western blotting
All lanes: Anti CD18 (ASA-B0358) at 0.5ug/ml
Lane 1: HELA Whole Cell Lysate at 40ug
Lane 2: JURKAT Whole Cell Lysate at 40ug
Lane 3: HT1080 Whole Cell Lysate at 40ug
Predicted bind size: 85KD
Observed bind size: 85KD