Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| CD36 molecule (thrombospondin receptor) | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the N-terminus of human CD36 (31-66aa DLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFW), different from the related mouse sequence by six amino acids, and from the related rat sequence by four amino acids. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
CD36 |
Protein |
Platelet glycoprotein 4 |
Uniprot ID |
P16671 |
Function |
Binds to collagen, thrombospondin, anionic phospholipids and oxidized low-density lipoprotein (oxLDL). May function as a cell adhesion molecule. Directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes. Binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Receptor for thombospondins, THBS1 AND THBS2, mediating their antiangiogenic effects. As a coreceptor for TLR4-TLR6 heterodimer, promotes inflammation in monocytes/macrophages. Upon ligand binding, such as oxLDL or amyloid-beta 42, rapidly induces the formation of a heterodimer of TLR4 and TLR6, which is internalized and triggers inflammatory response, leading to NF-kappa-B-dependent production of CXCL1, CXCL2 and CCL9 cytokines, via MYD88 signaling pathway, and CCL5 cytokine, via TICAM1 signaling pathway, as well as IL1B secretion. |
Tissue Specificity |
|
Sub-cellular localization |
Cell membrane; Multi-pass membrane protein. Note: Upon ligand-binding, internalized through dynamin-dependent endocytosis. |
Sequence Similarities |
Belongs to the CD36 family. |
Aliases |
Adipocyte membrane protein antibody|CD36 antibody|CD36 antibody|CD36 antigen (collagen type I receptor, thrombospondin receptor) antibody|CD36 antigen antibody|CD36 molecule (thrombospondin receptor) antibody|CD36 molecule antibody|CD36_HUMAN antibody|CHDS7 antibody|Cluster determinant 36 antibody|Collagen receptor, platelet antibody|FAT antibody| Fatty acid translocase antibody|Fatty acid transport protein antibody|Glycoprotein IIIb antibody|GP IIIb antibody|GP3B antibody|GP4 antibody|GPIIIB antibody|GPIV antibody| Leukocyte differentiation antigen CD36 antibody|MGC108510 antibody| MGC91634 antibody|PAS 4 protein antibody|PAS IV antibody|PAS-4 antibody| PASIV antibody|Platelet collagen receptor antibody|Platelet glycoprotein 4 antibody|Platelet glycoprotein IV antibody|scarb3 antibody|Scavenger receptor class B member 3 antibody|Thrombospondin receptor antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human, Mouse, Rat | AssaySolutio’s ECL kit |
| Immunohistochemistry(Paraffin-embedded Section) | 0.5-1μg/ml | Human, Rat | AssaySolutio’s IHC/ICC Detection kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information

Anti- CD36 antibody, ASA-B0378, Western blotting
All lanes: Anti CD36 (ASA-B0378) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: Rat Cardiac Muscle Tissue Lysate at 50ug
Lane 3: Mouse Liver Tissue Lysate at 50ug
Lane 4: Mouse Cardiac Muscle Tissue Lysate at 50ug
Lane 5: SMMC Whole Cell Lysate at 40ug
Predicted bind size: 53KD
Observed bind size: 88KD
All lanes: Anti CD36 (ASA-B0378) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: Rat Cardiac Muscle Tissue Lysate at 50ug
Lane 3: Mouse Liver Tissue Lysate at 50ug
Lane 4: Mouse Cardiac Muscle Tissue Lysate at 50ug
Lane 5: SMMC Whole Cell Lysate at 40ug
Predicted bind size: 53KD
Observed bind size: 88KD

Anti- CD36 antibody, ASA-B0378, IHC(P)
IHC(P): Rat Spleen Tissue
IHC(P): Rat Spleen Tissue





