Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| carnitine palmitoyltransferase 1B (muscle) | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the N-terminus of human CPT1B (197-226aa DDEEYYRMELLAKEFQDKTAPRLQKYLVLK), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
CPT1B |
Protein |
Carnitine O-palmitoyltransferase 1, muscle isoform |
Uniprot ID |
Q92523 |
Function |
|
Tissue Specificity |
Strong expression in heart and skeletal muscle. No expression in liver and kidney. |
Sub-cellular localization |
Mitochondrion outer membrane; Multi-pass membrane protein. |
Sequence Similarities |
Belongs to the carnitine/choline acetyltransferase family. |
Aliases |
muscle isoform antibody|Carnitine O palmitoyltransferase I mitochondrial muscle isoform antibody|Carnitine O palmitoyltransferase I muscle isoform antibody|Carnitine O-palmitoyl transferase 1, muscle isoform antibody| Carnitine O-palmitoyltransferase I antibody| Carnitine palmitoyltransferase 1A (muscle) antibody|Carnitine palmitoyltransferase 1B (muscle) antibody| Carnitine palmitoyltransferase 1B antibody|Carnitine palmitoyltransferase I like protein antibody|Carnitine palmitoyltransferase I muscle antibody|Carnitine palmitoyltransferase I-like protein antibody|CPT 1B antibody|CPT I antibody| CPT1 M antibody|CPT1 muscle antibody|CPT1-M antibody|Cpt1b antibody| CPT1B_HUMAN antibody|CPT1M antibody|CPTI antibody|CPTI M antibody| CPTI muscle antibody|CPTI-M antibody|CPTIM antibody| FLJ55729 antibody| FLJ58750 antibody|KIAA1670 antibody|M CPT1 antibody|M-CPT1 antibody| MCCPT1 antibody|MCPT1 antibody|muscle isoform antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human, Mouse, Rat | AssaySolutio’s ECL kit |
| Immunohistochemistry(Paraffin-embedded Section) | 0.5-1μg/ml | Mouse, Rat Human | AssaySolutio’s IHC/ICC Detection kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information
Anti- CPT1B antibody, ASA-B0496, Western blotting
All lanes: Anti CPT1B (ASA-B0496) at 0.5ug/ml
Lane 1: Rat Skeletal Muscle Tissue Lysate at 50ug
Lane 2: Rat Cardiac Muscle Tissue Lysate at 50ug
Lane 3: Mouse Skeletal Muscle Tissue Lysate at 50ug
Lane 4: Mouse Cardiac Muscle Tissue Lysate at 50ug
Lane 5: HELA Whole Cell Lysate at 40ug
Predicted bind size: 88KD
Observed bind size: 88KD
All lanes: Anti CPT1B (ASA-B0496) at 0.5ug/ml
Lane 1: Rat Skeletal Muscle Tissue Lysate at 50ug
Lane 2: Rat Cardiac Muscle Tissue Lysate at 50ug
Lane 3: Mouse Skeletal Muscle Tissue Lysate at 50ug
Lane 4: Mouse Cardiac Muscle Tissue Lysate at 50ug
Lane 5: HELA Whole Cell Lysate at 40ug
Predicted bind size: 88KD
Observed bind size: 88KD
Anti- CPT1B antibody, ASA-B0496, IHC(P)
IHC(P): Mouse Skeletal Muscle Tissue
IHC(P): Mouse Skeletal Muscle Tissue
Anti- CPT1B antibody, ASA-B0496, IHC(P)
IHC(P): Rat Cardiac Muscle Tissue
IHC(P): Rat Cardiac Muscle Tissue
