Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| fascin homolog 1, actin-bundling protein (Strongylocentrotus purpuratus) | Polyclonal | IgG | Rabbit | Human, Rat | WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the N-terminus of human Fascin (42-73aa KKQIWTLEQPPDEAGSAAVCLRSHLGRYLAAD), identical to the related mouse sequence, and different from the related rat sequence by one amino acid. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
FSCN1 |
Protein |
Fascin |
Uniprot ID |
Q16658 |
Function |
Organizes filamentous actin into bundles with a minimum of 4.1:1 actin/fascin ratio. Plays a role in the organization of actin filament bundles and the formation of microspikes, membrane ruffles, and stress fibers. Important for the formation of a diverse set of cell protrusions, such as filopodia, and for cell motility and migration. |
Tissue Specificity |
Ubiquitous. |
Sub-cellular localization |
Cytoplasm, cytoskeleton. Cell projection, filopodium. Cell projection, invadopodium. Cytoplasm, cytosol. Note: In glioma cells, partially colocalizes with F-actin stress fibers in the cytosol. |
Sequence Similarities |
Belongs to the fascin family. |
Aliases |
55 kDa actin bundling protein antibody|55 kDa actin-bundling protein antibody|Actin bundling protein antibody|actin bundling protein, 55-KD antibody|FAN 1 antibody|FAN1 antibody|Fascin 1 antibody|Fascin antibody|Fascin homolog 1 actin bundling protein (Strongylocentrotus purpuratus) antibody|Fascin homolog 1 antibody|Fascin, sea urchin, homolog of, 1 antibody|Fascin1 antibody| FLJ38511 antibody|FSCN 1 antibody|FSCN1 antibody|FSCN1_HUMAN antibody|HSN antibody|p55 antibody|Singed (Drosophila) like (sea urchin fascin homolog like) antibody|Singed drosophila homolog like antibody|Singed like (fascin homolog sea urchin) (Drosophila) antibody|Singed like (fascin homolog sea urchin) antibody|Singed like protein antibody|Singed, drosophila, homolog of antibody|Singed-like protein antibody|SNL antibody| Strongylocentrotus purpuratus antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human, Rat | AssaySolutio’s ECL kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information
Anti- Fascin antibody, ASA-B0689, Western blotting
All lanes: Anti Fascin (ASA-B0689) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Rat Lung Tissue Lysate at 50ug
Lane 3: HELA Whole Cell Lysate at 40ug
Lane 4: SKOV Whole Cell Lysate at 40ug
Predicted bind size: 55KD
Observed bind size: 55KD
All lanes: Anti Fascin (ASA-B0689) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Rat Lung Tissue Lysate at 50ug
Lane 3: HELA Whole Cell Lysate at 40ug
Lane 4: SKOV Whole Cell Lysate at 40ug
Predicted bind size: 55KD
Observed bind size: 55KD
