Fascin Antibody

$365.00

In stock

SKU: ASA-B0689 Category:

Description

Overview

Long Name

Antibody Type

Antibody Isotype

Host

Species Reactivity

Validated Applications

Purification 

fascin homolog 1, actin-bundling protein (Strongylocentrotus purpuratus) Polyclonal IgG Rabbit Human, Rat WB Immunogen affinity purified.

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human Fascin (42-73aa KKQIWTLEQPPDEAGSAAVCLRSHLGRYLAAD), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.

Properties

Form

Lyophilized

Size

100 µg/vial

Contents

Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request.

Concentration

Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration).

Storage

At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

Additional Information Regarding the Antigen

Gene

FSCN1

Protein

Fascin

Uniprot ID

Q16658

Function

Organizes filamentous actin into bundles with a minimum of 4.1:1 actin/fascin ratio. Plays a role in the organization of actin filament bundles and the formation of microspikes, membrane ruffles, and stress fibers. Important for the formation of a diverse set of cell protrusions, such as filopodia, and for cell motility and migration.

Tissue Specificity

Ubiquitous.

Sub-cellular localization

Cytoplasm, cytoskeleton. Cell projection, filopodium. Cell projection, invadopodium. Cytoplasm, cytosol. Note: In glioma cells, partially colocalizes with F-actin stress fibers in the cytosol.

Sequence Similarities

Belongs to the fascin family.

Aliases

55 kDa actin bundling protein antibody|55 kDa actin-bundling protein antibody|Actin bundling protein antibody|actin bundling protein, 55-KD antibody|FAN 1 antibody|FAN1 antibody|Fascin 1 antibody|Fascin antibody|Fascin homolog 1 actin bundling protein (Strongylocentrotus purpuratus) antibody|Fascin homolog 1 antibody|Fascin, sea urchin, homolog of, 1 antibody|Fascin1 antibody| FLJ38511 antibody|FSCN 1 antibody|FSCN1 antibody|FSCN1_HUMAN antibody|HSN antibody|p55 antibody|Singed (Drosophila) like (sea urchin fascin homolog like) antibody|Singed drosophila homolog like antibody|Singed like (fascin homolog sea urchin) (Drosophila) antibody|Singed like (fascin homolog sea urchin) antibody|Singed like protein antibody|Singed, drosophila, homolog of antibody|Singed-like protein antibody|SNL antibody| Strongylocentrotus purpuratus antibody

Application Details

Application Concentration* Species Validated Using**
Western blot 0.1-0.5μg/ml Human, Rat AssaySolutio’s ECL kit

AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information

Anti- Fascin antibody, ASA-B0689, Western blotting
All lanes: Anti Fascin (ASA-B0689) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Rat Lung Tissue Lysate at 50ug
Lane 3: HELA Whole Cell Lysate at 40ug
Lane 4: SKOV Whole Cell Lysate at 40ug
Predicted bind size: 55KD
Observed bind size: 55KD