Fractalkine Human Recombinant ( CX3CL1 ) ( Fractalkine Human )

Price range: $192.50 through $2,910.60

SKU: PT_40618 Category:

Description

Data Sheet

Amino acid sequence QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQW VKDAMQHLDRQAAALTRNG.
Biological Activity The Biological activity is calculated by its ability to chemoattract human T-Lymphocytes using a concentration range of 5.0-10.0 ng/ml corresponding to a Specific Activity of 100,000-200,000IU/mg.
Description Fractalkine Human Recombinant- produced in E.Coli is a single,non-glycosylated, polypeptide chain containing 76 amino acids and having a molecular mass of 8638 Dalton. The Fractalkine is purified by proprietary chromatographic techniques.
Expression host Escherichia Coli.
Formulation The CX3CL1 was lyophilized from a 0.2m filtered concentrated (1.0 mg/ml) solution in 20mM Phosphate buffer, pH 7.4, 50mM NaCl.
Protein Background Fractalkine soluble form is chemotactic for t-cells and monocytes, but not for neutrophils. Fractalkine membrane-bound form promotes adhesion of those leukocytes to endothelial cells. Fractalkine regulates leukocyte adhesion and migration processes at the endothelium and binds to CX3CR1. Natural Human Fractalkine is produced as a long protein (373-amino acid) with an extended mucin-like stalk and a chemokine domain on top. The mucin-like stalk permits it to bind to the cell surface. Fractalkine gene is located on human chromosome 16 along with some CC chemokines known as CCL17 and CCL22.
Purity Greater than 97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Reagent Appearance Sterile Filtered White lyophilized (freeze-dried) powder.
References Title: Glial Cell Line-Derived Neurotrophic Factor and Neurturin Inhibit Neurite Outgrowth and Activate RhoA through GFR?2b, an Alternatively Spliced Isoform of GFR?2.Publication: The Journal of Neuroscience, 23 May 2007, 27(21): 5603-5614; doi: 10.1523/?JNEUROSCI.4552-06.2007.Link: http://www.jneurosci.org/content/27/21/5603.fullApplications: GFR?2 when activated by NTN, it inhibits neurite outgrowth induced by GFR?1a, GFR?2a, and GFR?2c isoforms.
Solubility It is recommended to reconstitute the lyophilized CX3CL1 in sterile 18M-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.
Stability Lyophilized CX3CL1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CX3CL1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Synonyms Fractalkine, CX3CL1, Neurotactin, CX3C membrane-anchored chemokine, Small inducible cytokine D1, NTN, NTT, CXC3, CXC3C, SCYD1, ABCD-3, C3Xkine.

Additional information

Size

5ug, 1mg, 20ug