Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group) | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the N-terminus of human FUT1 (134-164aa EVDSRTPWRELQLHDWMSEEYADLRDPFLKL), different from the related mouse and rat sequences by seven amino acids. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
FUT1 |
Protein |
Galactoside 2-alpha-L-fucosyltransferase 1 |
Uniprot ID |
P19526 |
Function |
Creates a soluble precursor oligosaccharide FuC-alpha ((1,2)Galbeta-) called the H antigen which is an essential substrate for the final step in the soluble A and B antigen synthesis pathway. H and Se enzymes fucosylate the same acceptor substrates but exhibit different Km values. |
Tissue Specificity |
|
Sub-cellular localization |
Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Note: Membrane-bound form in trans cisternae of Golgi. |
Sequence Similarities |
Belongs to the glycosyltransferase 11 family. |
Aliases |
2)FT 1 antibody|2-alpha-L-fucosyltransferase antibody|Alpha (1 2) fucosyltransferase antibody|Alpha(1 2)FT 1 antibody|Alpha(1 antibody|Blood group H alpha 2-fucosyltransferase antibody|fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase) antibody|Fucosyltransferase 1 antibody|FUT1 antibody|FUT1_HUMAN antibody|Galactoside 2 alpha L fucosyltransferase antibody|Galactoside 2-alpha-L-fucosyltransferase 1 antibody|GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1 antibody|H antibody|HH antibody|HSC antibody|Para Bombay phenotype antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human, Rat | AssaySolutio’s ECL kit |
| Immunohistochemistry(Paraffin-embedded Section) | 0.5-1μg/ml | Human, Mouse, Rat | AssaySolutio’s IHC/ICC Detection kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information

Anti- FUT1 antibody, ASA-B0740, Western blotting
All lanes: Anti FUT1 (ASA-B0740) at 0.5ug/ml
Lane 1: Rat Kidney Tissue Lysate at 50ug
Lane 2: SW620 Whole Cell Lysate at 40ug
Lane 3: A549 Whole Cell Lysate at 40ug
Predicted bind size: 50KD
Observed bind size: 50KD
All lanes: Anti FUT1 (ASA-B0740) at 0.5ug/ml
Lane 1: Rat Kidney Tissue Lysate at 50ug
Lane 2: SW620 Whole Cell Lysate at 40ug
Lane 3: A549 Whole Cell Lysate at 40ug
Predicted bind size: 50KD
Observed bind size: 50KD

Anti- FUT1 antibody, ASA-B0740, IHC(P)
IHC(P): Mouse Intestine Tissue
IHC(P): Mouse Intestine Tissue

Anti- FUT1 antibody, ASA-B0740, IHC(P)
IHC(P): Rat Intestine Tissue
IHC(P): Rat Intestine Tissue




