Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| lectin, galactoside-binding, soluble, 8 | Polyclonal | IgG | Rabbit | Human, Rat | WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human Galectin 8 (286-317aa HSLEYKHRFKELSSIDTLEINGDIHLLEVRSW), different from the related mouse and rat sequences by six amino acids. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
LGALS8 |
Protein |
Galectin-8 |
Uniprot ID |
O00214 |
Function |
|
Tissue Specificity |
|
Sub-cellular localization |
|
Sequence Similarities |
|
Aliases |
Gal 8 antibody|Gal-8 antibody|Gal8 antibody|Galectin-8 antibody|galectin-8g antibody|Lectin galactoside binding soluble 8 antibody| LEG8_HUMAN antibody|LGAL S8 antibody|Lgals8 antibody|PCTA 1 antibody|PCTA-1 antibody|PCTA1 antibody|Po66 carbohydrate binding protein antibody|Po66 carbohydrate-binding protein antibody|Po66 CBP antibody|Po66-CBP antibody|Prostate carcinoma tumor antigen 1 antibody |
Application Details

Anti- Galectin 8 antibody, ASA-B0757, Western blotting
All lanes: Anti Galectin 8 (ASA-B0757) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Rat Kidney Tissue Lysate at 50ug
Lane 3: Human Placenta Tissue Lysate at 50ug
Lane 4: HELA Whole Cell Lysate at 40ug
Lane 5: A431 Whole Cell Lysate at 40ug
Predicted bind size: 36KD
Observed bind size: 50KD
All lanes: Anti Galectin 8 (ASA-B0757) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Rat Kidney Tissue Lysate at 50ug
Lane 3: Human Placenta Tissue Lysate at 50ug
Lane 4: HELA Whole Cell Lysate at 40ug
Lane 5: A431 Whole Cell Lysate at 40ug
Predicted bind size: 36KD
Observed bind size: 50KD





