Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| hematopoietically expressed homeobox | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence in the middle region of human Hex(146-180aa NDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQ), different from the related mouse sequence by one amino acid. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
HHEX |
Protein |
Hematopoietically-expressed homeobox protein Hhex |
Uniprot ID |
Q03014 |
Function |
|
Tissue Specificity |
|
Sub-cellular localization |
|
Sequence Similarities |
|
Aliases |
Hematopoietically expressed homeobox antibody|Hematopoietically-expressed homeobox protein HHEX antibody|HEX antibody|HHEX antibody|HHEX_HUMAN antibody|HMPH antibody|Homeobox hematopoietically expressed antibody|Homeobox protein HEX antibody| Homeobox protein PRH antibody|HOX11L PEN antibody|PRH antibody|PRHX antibody|Proline rich homeodomain containing transcription factor antibody| OTTHUMP00000206478 antibody|OTTHUMP00000206479 antibody|OTTHUMP00000206480 antibody|OTTHUMP00000206482 antibody|OTTHUMP00000207360 antibody|USURPIN antibody|Usurpin beta antibody |
Application Details
Anti- Hex antibody, ASA-B0857, Western blotting
All lanes: Anti Hex (ASA-B0857) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: Mouse Liver Tissue Lysate at 50ug
Lane 3: HEPG Whole Cell Lysate at 40ug
Predicted bind size: 47KD
Observed bind size: 47KD
All lanes: Anti Hex (ASA-B0857) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: Mouse Liver Tissue Lysate at 50ug
Lane 3: HEPG Whole Cell Lysate at 40ug
Predicted bind size: 47KD
Observed bind size: 47KD
