HIF-2-alpha Antibody

$330.00

In stock

SKU: ASA-B0864 Category:

Description

Overview

Long Name

Antibody Type

Antibody Isotype

Host

Species Reactivity

Validated Applications

Purification 

endothelial PAS domain protein 1 Polyclonal IgG Rabbit Rat IHC-P, WB Immunogen affinity purified.

Immunogen

A synthetic peptide corresponding to a sequence at N-terminus of rat HIF-2-alpha(202-240aa YNNCPPHSSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLD).

Properties

Form

Lyophilized

Size

100 µg/vial

Contents

Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Thimerosal and 0.05 mg NaN3. *carrier free antibody available upon request.

Concentration

Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration).

Storage

At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

Additional Information Regarding the Antigen

Gene

EPAS1

Protein

Endothelial PAS domain-containing protein 1(EPAS-1)

Uniprot ID

Q9JHS1

Function

Transcription factor involved in the induction of oxygen regulated genes. Binds to core DNA sequence 5′-[AG]CGTG-3′ within the hypoxia response element (HRE) of target gene promoters. Regulates the vascular endothelial growth factor (VEGF) expression and seems to be implicated in the development of blood vessels and the tubular system of lung. May also play a role in the formation of the endothelium that gives rise to the blood brain barrier. Potent activator of the Tie-2 tyrosine kinase expression. Activation seems to require recruitment of transcriptional coactivators such as CREBPB and probably EP300. Interaction with redox regulatory protein APEX seems to activate CTAD (By similarity).

Tissue Specificity

Sub-cellular localization

Nucleus.

Sequence Similarities

Contains 1 bHLH (basic helix-loop-helix) domain.

Aliases

Basic helix loop helix PAS protein MOP2 antibody|Basic-helix-loop-helix-PAS protein MOP2 antibody|bHLHe73 antibody|Class E basic helix-loop-helix protein 73 antibody|ECYT4 antibody|Endothelial PAS domain containing protein 1 antibody|Endothelial pas domain protein 1 antibody|Endothelial PAS domain-containing protein 1 antibody|EPAS 1 antibody|EPAS-1 antibody|EPAS1 antibody|EPAS1_HUMAN antibody|HIF 1 alpha like factor antibody|HIF 2 alpha antibody|HIF-1-alpha-like factor antibody|HIF-2-alpha antibody|HIF2-alpha antibody|Hif2a antibody|HLF antibody|Hypoxia inducible factor 2 alpha antibody|Hypoxia inducible factor 2 alpha subunit antibody|Hypoxia-inducible factor 2-alpha antibody|Member of PAS protein 2 antibody|Member of pas superfamily 2 antibody|MOP 2 antibody|MOP2 antibody|PAS domain-containing protein 2 antibody|PASD2 antibody

Application Details

Application Concentration* Species Validated Using**
Western blot 0.1-0.5μg/ml Rat AssaySolutio’s ECL kit
Immunohistochemistry(Paraffin-embedded Section) 0.5-1μg/ml Rat AssaySolutio’s IHC/ICC Detection kit

AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information

Anti-HIF-2-alpha antibody, ASA-B0864, Western blotting
WB: Rat Brain Tissue Lysate
Anti-HIF-2-alpha antibody, ASA-B0864, IHC(P)
IHC(P): Rat Small Intestine Tissue