Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| high mobility group box 3 | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the N-terminus of human HMG4 (62-95aa EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR), identical to the related mouse and rat sequences. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
HMGB3 |
Protein |
High mobility group protein B3 |
Uniprot ID |
O15347 |
Function |
|
Tissue Specificity |
|
Sub-cellular localization |
|
Sequence Similarities |
|
Aliases |
chromosomal protein, Nonhistone, HMG4 antibody|High mobility group (nonhistone chromosomal) protein 4 antibody|High mobility group box 3 antibody|High mobility group protein 2a antibody|High mobility group protein 4 antibody|High mobility group protein B3 antibody|High mobility group protein HMG4 antibody|HMG 4 antibody|HMG-2a antibody|HMG-4 antibody|HMG2A antibody|HMGB 3 antibody|HMGB3 antibody| HMGB3_HUMAN antibody|MGC90319 antibody|Non histone chromosomal protein antibody|Nonhistone chromosomal protein HMG4 antibody |
Application Details
Anti- HMG4 antibody, ASA-B0874, Western blotting
All lanes: Anti HMG4 (ASA-B0874) at 0.5ug/ml
Lane 1: Mouse Liver Tissue Lysate at 50ug
Lane 2: Mouse Kidney Tissue Lysate at 50ug
Lane 3: Mouse Testis Tissue Lysate at 50ug
Lane 4: 22RV1 Whole Cell Lysate at 40ug
Lane 5: MCF-7 Whole Cell Lysate at 40ug
Lane 6: NIH3T3 Whole Cell Lysate at 40ug
Predicted bind size: 23KD
Observed bind size: 23KD
All lanes: Anti HMG4 (ASA-B0874) at 0.5ug/ml
Lane 1: Mouse Liver Tissue Lysate at 50ug
Lane 2: Mouse Kidney Tissue Lysate at 50ug
Lane 3: Mouse Testis Tissue Lysate at 50ug
Lane 4: 22RV1 Whole Cell Lysate at 40ug
Lane 5: MCF-7 Whole Cell Lysate at 40ug
Lane 6: NIH3T3 Whole Cell Lysate at 40ug
Predicted bind size: 23KD
Observed bind size: 23KD
Anti- HMG4 antibody, ASA-B0874, IHC(P)
IHC(P): Mouse Intestine Tissue
IHC(P): Mouse Intestine Tissue
Anti- HMG4 antibody, ASA-B0874, IHC(P)
IHC(P): Rat Intestine Tissue
IHC(P): Rat Intestine Tissue
