Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| HNF1 homeobox B | Polyclonal | IgG | Rabbit | Human, Rat | WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human HNF1 beta (496-525aa AQQPFMAAVTQLQNSHMYAHKQEPPQYSHT), identical to the related mouse and rat sequences. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
HNF1B |
Protein |
Hepatocyte nuclear factor 1-beta |
Uniprot ID |
P35680 |
Function |
Transcription factor, probably binds to the inverted palindrome 5′-GTTAATNATTAAC-3′. |
Tissue Specificity |
|
Sub-cellular localization |
Nucleus. |
Sequence Similarities |
Belongs to the HNF1 homeobox family. |
Aliases |
FJHN antibody|Hepatocyte nuclear factor 1 beta antibody|Hepatocyte nuclear factor 1-beta antibody|HNF 1B antibody|HNF 2 antibody|HNF-1-beta antibody|HNF-1B antibody|HNF1 beta antibody|HNF1 homeobox B antibody|HNF1B antibody|HNF1beta antibody|HNF2 antibody| Homeoprotein LF B3 antibody|Homeoprotein LFB3 antibody|HPC11 antibody|LF B3 antibody|LFB3 antibody|MODY 5 antibody|MODY5 antibody| TCF 2 antibody|TCF 2 protein antibody|TCF-2 antibody|TCF2 antibody|TCF2 protein antibody|Transcription factor 2 antibody|Transcription factor 2 hepatic antibody|Variant hepatic nuclear factor 1 antibody|Variant hepatic nuclear factor antibody|VHNF 1 antibody|vHNF1 antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human, Rat | AssaySolutio’s ECL kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information

Anti- HNF1 beta antibody, ASA-B0882, Western blotting
All lanes: Anti HNF1 beta (ASA-B0882) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: Rat Kidney Tissue Lysate at 50ug
Lane 3: SW620 Whole Cell Lysate at 40ug
Predicted bind size: 61KD
Observed bind size: 61KD
All lanes: Anti HNF1 beta (ASA-B0882) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: Rat Kidney Tissue Lysate at 50ug
Lane 3: SW620 Whole Cell Lysate at 40ug
Predicted bind size: 61KD
Observed bind size: 61KD





