Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| heat shock 70kDa protein 1A | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp70 (559-596aa KGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKR), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
HSPA1A |
Protein |
Heat shock 70 kDa protein 1A/1B |
Uniprot ID |
P0DMV8 |
Function |
|
Tissue Specificity |
|
Sub-cellular localization |
|
Sequence Similarities |
|
Aliases |
DAQB 147D11.1 001 antibody|FLJ54303 antibody|FLJ54370 antibody|FLJ54392 antibody|FLJ54408 antibody|FLJ75127 antibody|Heat shock 70 kDa protein 1 antibody|Heat shock 70 kDa protein 1/2 antibody|Heat shock 70 kDa protein 1A/1B antibody|heat shock 70kDa protein 1A antibody|Heat shock 70kDa protein 1B antibody|Heat shock induced protein antibody|heat shock protein 70 antibody|HSP70 1 antibody| HSP70 2 antibody|HSP70-1/HSP70-2 antibody|HSP70-1A antibody| HSP70.1 antibody|HSP70.1/HSP70.2 antibody|HSP70I antibody|HSP71_HUMAN antibody|HSP72 antibody|HSPA1 antibody|HSPA1A antibody|HSPA1B antibody|XXbac BCX40G17.3 001 antibody |
Application Details
Anti- Hsp70 antibody, ASA-B0920, Western blotting
All lanes: Anti Hsp70 (ASA-B0920) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: Rat Thymus Tissue Lysate at 50ug
Lane 3: Mouse Liver Tissue Lysate at 50ug
Lane 4: Mouse Kidney Tissue Lysate at 50ug
Lane 5: HELA Whole Cell Lysate at 40ug
Lane 6: MCF-7 Whole Cell Lysate at 40ug
Predicted bind size: 70KD
Observed bind size: 70KD
All lanes: Anti Hsp70 (ASA-B0920) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: Rat Thymus Tissue Lysate at 50ug
Lane 3: Mouse Liver Tissue Lysate at 50ug
Lane 4: Mouse Kidney Tissue Lysate at 50ug
Lane 5: HELA Whole Cell Lysate at 40ug
Lane 6: MCF-7 Whole Cell Lysate at 40ug
Predicted bind size: 70KD
Observed bind size: 70KD
Anti- Hsp70 antibody, ASA-B0920, IHC(P)
IHC(P): Mouse Intestine Tissue
IHC(P): Mouse Intestine Tissue
Anti- Hsp70 antibody, ASA-B0920, IHC(P)
IHC(P): Rat Intestine Tissue
IHC(P): Rat Intestine Tissue
