Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| heat shock protein 90kDa alpha (cytosolic), class B member 1 | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp90 beta (449-481aa RRLSELLRYHTSQSGDEMTSLSEYVSRMKETQK), identical to the related mouse and rat sequences. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
HSP90AB1 |
Protein |
Heat shock protein HSP 90-beta |
Uniprot ID |
P08238 |
Function |
|
Tissue Specificity |
|
Sub-cellular localization |
|
Sequence Similarities |
|
Aliases |
90 kda heat shock protein beta HSP90 beta antibody|D6S182 antibody|FLJ26984 antibody|Heat shock 84 kDa antibody|Heat shock 90kD protein 1, beta antibody|Heat shock 90kDa protein 1 beta antibody|Heat shock protein 90kDa alpha (cytosolic) class B member 1 antibody|Heat shock protein beta antibody|Heat shock protein HSP 90 beta antibody|Heat shock protein HSP 90-beta antibody|HS90B_HUMAN antibody|HSP 84 antibody|HSP 90 antibody|HSP 90 b antibody|HSP 90b antibody|HSP84 antibody|HSP90 BETA antibody|hsp90ab1 antibody|HSP90B antibody|HSPC2 antibody|HSPCB antibody |
Application Details
Anti- Hsp90 beta antibody, ASA-B0925, Western blotting
All lanes: Anti Hsp90 beta (ASA-B0925) at 0.5ug/ml
Lane 1: Rat Testis Tissue Lysate at 50ug
Lane 2: Rat Thymus Tissue Lysate at 50ug
Lane 3: Human Placenta Tissue Lysate at 50ug
Lane 4: SW620 Whole Cell Lysate at 40ug
Lane 5: HELA Whole Cell Lysate at 40ug
Predicted bind size: 90KD
Observed bind size: 90KD
All lanes: Anti Hsp90 beta (ASA-B0925) at 0.5ug/ml
Lane 1: Rat Testis Tissue Lysate at 50ug
Lane 2: Rat Thymus Tissue Lysate at 50ug
Lane 3: Human Placenta Tissue Lysate at 50ug
Lane 4: SW620 Whole Cell Lysate at 40ug
Lane 5: HELA Whole Cell Lysate at 40ug
Predicted bind size: 90KD
Observed bind size: 90KD
Anti- Hsp90 beta antibody, ASA-B0925, IHC(P)
IHC(P): Mouse Testis Tissue
IHC(P): Mouse Testis Tissue
Anti- Hsp90 beta antibody, ASA-B0925, IHC(P)
IHC(P): Rat Intestine Tissue
IHC(P): Rat Intestine Tissue
